DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and mfrn

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:298 Identity:66/298 - (22%)
Similarity:118/298 - (39%) Gaps:52/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LFPLTVIKTQLQVQHKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSG---VFYISTYEG 118
            ::||..:||::|..........:|.....:...||:....||  .|:|.:.:|   ..|.:.||.
  Fly    32 MYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPIRG--ASAVVLGAGPAHSLYFAAYEM 94

  Fly   119 VRHVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWP 183
            .:.:.....:...:..:..|..|:|:...|..|.|||.|                          
  Fly    95 TKELTAKFTSVRNLNYVISGAVATLIHDAISSPTDVIKQ-------------------------- 133

  Fly   184 GRSRLHIS-----MDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDEL---FRIC 240
             |.:::.|     :...|:|.:|:||:.|||.|...|:..:|...:.:..|..:|:::   .:..
  Fly   134 -RMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYN 197

  Fly   241 PVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLD---SMSVAFRELWQEEKLNCFFKG 302
            |.      :...||:..|.....:|.|||:::..|......   .|..|.|:::.......||:|
  Fly   198 PP------VHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIYHMAGPLGFFRG 256

  Fly   303 LSARLVQSAAFSFSIILGYETIK--RIAVD-EQYKHQI 337
            .:||::.|...:......||..|  ...:| :|||..|
  Fly   257 TTARVLYSMPATAICWSTYEFFKFYLCGLDADQYKSSI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 16/70 (23%)
Mito_carr 132..238 CDD:395101 24/113 (21%)
Mito_carr 245..327 CDD:395101 20/86 (23%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 16/67 (24%)
PTZ00168 17..280 CDD:185494 60/282 (21%)
Mito_carr 107..190 CDD:278578 24/109 (22%)
Mito_carr <215..282 CDD:278578 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.