DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and DPCoAC

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:371 Identity:77/371 - (20%)
Similarity:133/371 - (35%) Gaps:110/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TESSSSTKSRLAVAPTG----------------VGGAAEGATYIRTIEWDMMNKTKFFPLSMLSS 50
            |:.|.|..|.:.:.|..                :.|||.||          :.||...||.    
  Fly    44 TQLSPSETSGVVLVPATTVTPMRQKIDQVVISLISGAAAGA----------LAKTVIAPLD---- 94

  Fly    51 FSVRCCLFPLTVIKTQLQVQHKSDV---YKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVS-GVF 111
                         :|::..|.::||   ::..:......|.:|||..|:||...:..:||. ...
  Fly    95 -------------RTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAI 146

  Fly   112 YISTYEGVR---HVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGD 173
            ..:.:|..|   ||..| |...:.:....|..|.:..|::..|.|:                   
  Fly   147 QFTAHEQWRRILHVDKD-GTNTKGRRFLAGSLAGITSQSLTYPLDL------------------- 191

  Fly   174 INPLGIKSWPGRSRLHIS---------MDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFY 229
                      .|:|:.::         ..:..:|...:|.|..:|||.|:::..:|.:...:..|
  Fly   192 ----------ARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTY 246

  Fly   230 HLYQDELFRICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHR------------LDS 282
            ...:.|.:.:......:..:....|:..|......:.||||||.|:|..|            |::
  Fly   247 ETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILET 311

  Fly   283 MSVAFRELWQEEKLNCFFKGLSARLVQ---SAAFSFSIILGYETIK 325
            :...:||   |...|.|:||||...::   :...|||.   |:.||
  Fly   312 LVKIYRE---EGVKNGFYKGLSMNWIKGPIAVGISFST---YDLIK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 17/85 (20%)
Mito_carr 132..238 CDD:395101 17/114 (15%)
Mito_carr 245..327 CDD:395101 27/96 (28%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/113 (21%)
Mito_carr 169..251 CDD:278578 16/110 (15%)
Mito_carr 279..356 CDD:278578 25/79 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.