DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Dic1

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:308 Identity:76/308 - (24%)
Similarity:118/308 - (38%) Gaps:70/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSSFSVRCCLFPLTVIKTQLQVQHKSDVYKGMVDCAM---KIYRSEGVPGLYRGFWISSV-QIVS 108
            |:|........||.:||..||.|      :|.:..|.   |:.|.:||...|.|...|.: |:..
  Fly    15 LASVGAAMVTHPLDLIKVTLQTQ------QGHLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTY 73

  Fly   109 GVFYISTYEGVRHVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGD 173
            .......||..:..:|....|.:: |||  |.:.|||..:..|.|::           :...:.|
  Fly    74 STARFGVYEAGKKYVNTDSFGGKV-ALA--GASGLVGGIVGTPADMV-----------NVRMQND 124

  Fly   174 INPLGIKSWPGRSRLHISMDIGR-EIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYH------- 230
                 :|..|.:.|.:.:...|. .:.|::||:..:.|.||:....:..:....|||.       
  Fly   125 -----VKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLL 184

  Fly   231 ---LYQDELFRICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSMSVAFRELWQ 292
               .:||.|       |:|.....|||::    .|.||.|||:::.|    .:::....|..||.
  Fly   185 ATPYFQDNL-------VTHFTASLVAGTI----ATTLTQPLDVLKTR----SMNAKPGEFNGLWD 234

  Fly   293 EEKLNC------FFKGLSARLVQSAAFSFSIILGYETIKRIAVDEQYK 334
            ..|...      ||||.....|:         ||..||......||.:
  Fly   235 IVKHTAKLGPLGFFKGYVPAFVR---------LGPHTIITFVFLEQLR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 21/80 (26%)
Mito_carr 132..238 CDD:395101 26/116 (22%)
Mito_carr 245..327 CDD:395101 24/87 (28%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 22/82 (27%)
PTZ00169 13..273 CDD:240302 76/306 (25%)
Mito_carr 89..184 CDD:278578 25/113 (22%)
Mito_carr 189..278 CDD:278578 30/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.