DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Tpc1

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:338 Identity:78/338 - (23%)
Similarity:130/338 - (38%) Gaps:102/338 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSSFSVRCCLFPLTVIKTQLQVQHK--------------SDVYKGMVDCAMKIYRSEGVPGLYRG 98
            ||:...|....||.|:|.:.|:|.:              :..|..:......|||.||:...::|
  Fly    37 LSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKG 101

  Fly    99 FWISSVQIVS---GVFYISTYEGV-------------RHVLNDL-GAGHRMKALAGGGCASLVGQ 146
            .  :..|::|   |:....|||.:             :|:.|.| ||       |.||.|.::. 
  Fly   102 H--NPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGA-------AAGGAAVIIS- 156

  Fly   147 TIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGY 211
               .|.|||...     :.|...|||..|.....|               .|:|::|.||.|||.
  Fly   157 ---TPLDVIRTR-----LIAQDTSKGYRNATRAVS---------------AIVRQEGPRGMYRGL 198

  Fly   212 TASLMAYVPNSAMWWAFYHLYQDELFRIC-----------PVWVSHLFIQCVAGSLGGFTTTILT 265
            :::|:...|.....:..|.|:.|   ..|           |.|.     ....|:..|..:..:.
  Fly   199 SSALLQITPLMGTNFMAYRLFSD---WACAFLEVSDRSQLPTWT-----LLGLGASSGMLSKTIV 255

  Fly   266 NPLDIVRARLQVHRLDSMSVAFRE------LW-------QEEKLNCFFKGLSARLVQSA---AFS 314
            .|.|:::.|||:...:|....|.:      :|       ::|.:...:||::..|::|:   |..
  Fly   256 YPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALY 320

  Fly   315 FSIILGYETIKRI 327
            |||   |:.:|::
  Fly   321 FSI---YDKLKQV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 23/106 (22%)
Mito_carr 132..238 CDD:395101 27/105 (26%)
Mito_carr 245..327 CDD:395101 21/97 (22%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 22/87 (25%)
PTZ00169 33..329 CDD:240302 77/335 (23%)
Mito_carr 153..222 CDD:278578 23/95 (24%)
Mito_carr 233..328 CDD:278578 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.