DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and CG2616

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:416 Identity:80/416 - (19%)
Similarity:137/416 - (32%) Gaps:127/416 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TGVGGAAEGATYIR----TIEWDMMNK---TKFFPLSMLSS--FSVR----------------CC 56
            :|..|...|...::    ..|.|.:|:   :|.....:||.  |.:|                |.
  Fly    43 SGGSGGTSGGNNLKPERSAREDDAINRLTDSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACF 107

  Fly    57 LFPLTVIKTQLQVQ----HKSDVY-KGMV--------------------------DCAMKIYRSE 90
            :.||.||||::|.|    ||...| .|::                          |..|||.|.|
  Fly   108 MTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHE 172

  Fly    91 GVPGLYRGFWISSVQ-IVSGVFYISTYEGVRHVLNDLGAGHRMKA-------------------- 134
            |:..|:.|...:.|. :.|.:.|...||..:.....:...|..|:                    
  Fly   173 GLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVP 237

  Fly   135 LAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIM 199
            :..|..|.:...|::.|.:::.                      .|....|......:...|.::
  Fly   238 MMSGVTARICAVTVVSPIELVR----------------------TKMQAQRQTYAQMLQFVRSVV 280

  Fly   200 RRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRICPVWVSH-----LFIQCVAGSLGGF 259
            ...|..|.:||...:::..||.|.::|..|...:..|        .|     ..:..:||.:.|.
  Fly   281 ALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNL--------GHGSQPSFSLSFLAGVMAGT 337

  Fly   260 TTTILTNPLDIVRARLQV---HRL---DSMSVAFRE---------LWQEEKLNCFFKGLSARLVQ 309
            ...|:|.|.|:|:...|:   .|:   ||.:..|.:         :::...:...|.|...||::
  Fly   338 VAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLK 402

  Fly   310 SAAFSFSIILGYETIKRIAVDEQYKH 335
            .|.....:|..:|..|........:|
  Fly   403 VAPACAIMISTFEYSKSFFFHYNVRH 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 31/128 (24%)
Mito_carr 132..238 CDD:395101 18/125 (14%)
Mito_carr 245..327 CDD:395101 22/101 (22%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 29/120 (24%)
Mito_carr 230..321 CDD:278578 18/120 (15%)
Mito_carr 321..425 CDD:278578 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.