DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Bmcp

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:316 Identity:75/316 - (23%)
Similarity:123/316 - (38%) Gaps:65/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSSFSVRCCLFPLTVIKTQLQVQ-HKSDV------YKGMVDCAMKIYRSEGVPGLYRGFWISSV- 104
            ::|.:.....||:...||:||:| .|.|.      |:||.|..:||.|.||:..||.|.|.:.: 
  Fly    15 VASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLR 79

  Fly   105 QIVSGVFYISTYEGVRHVLNDLGA-----------GHRMKALAGGGCASLVGQTIIVPFDVISQH 158
            |...|.....||..::.:.|:.|.           .:.:.|.|.|..:|.:..    |.||:...
  Fly    80 QATYGTIKFGTYYTLKKL
ANERGLLINEDGSERVWSNILCAAAAGAISSAIAN----PTDVLKVR 140

  Fly   159 AMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSA 223
            ..|.|...|.|..|...                     ||.:.:|.||.:||...:....|..::
  Fly   141 MQVHGKGQHKGLLGCFG---------------------EIYKYEGVRGLWRGVGPTAQRAVVIAS 184

  Fly   224 MWWAFYHLYQDELFRICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSMSV--- 285
            :....|...:.:|.......|.:.||.....|||   :.|.:.|:|::|.||...|..|:::   
  Fly   185 VELPVYDFCKLQLMN
AFGDHVGNHFISSFIASLG---SAIASTPIDVIRTRLMNQRPVSITMNGV 246

  Fly   286 ----AFRELW-----------QEEKLNCFFKGLSARLVQSAAFSFSIILGYETIKR 326
                |..:|:           :.|.|...:||.....|:...::....:.||.:|:
  Fly   247 VTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 27/84 (32%)
Mito_carr 132..238 CDD:395101 22/105 (21%)
Mito_carr 245..327 CDD:395101 23/100 (23%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 27/81 (33%)
Mito_carr <132..199 CDD:278578 18/91 (20%)
Mito_carr 204..303 CDD:278578 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.