DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and CG7514

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:311 Identity:67/311 - (21%)
Similarity:123/311 - (39%) Gaps:78/311 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CCLFPLTVIKTQLQVQHKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTYEGV 119
            |.:.||.::||::|:...:..||...||.:|::::||:..||.|       :.:|:...:||...
  Fly    28 CIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNG-------LSAGLMRQATYTTA 85

  Fly   120 R-------------------HVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMS 165
            |                   .||..:|.|     :..|...::.|.    |.:|    |::..||
  Fly    86 RMGFYQMEIDAYRKQFNAPPTVLASMGMG-----ILAGAFGAMFGN----PAEV----ALIRMMS 137

  Fly   166 AHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASL-MAYVPNSAMWWAFY 229
            .:.     :.|...:::.|.....:      .|::.:|....::|...:: .|.:.|.....::.
  Fly   138 DNR-----LPPAERRNYTGVLNAFV------RIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYS 191

  Fly   230 HLYQ--DELFRICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRL----DSMSVAFR 288
            .|..  .|.|       |.|.:...|..:.|..|||.:.|||:.:.|:|..:.    .:|.|..:
  Fly   192 QLKAAFSEYF-------SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMK 249

  Fly   289 ELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYETIKRIAVDEQ----YKH 335
             :.:.|.:...:||.:..|.:         ||..|:......||    |||
  Fly   250 -VSKNEGIASLWKGFTPYLCR---------LGPHTVFAFIFLEQLTKAYKH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 22/88 (25%)
Mito_carr 132..238 CDD:395101 16/108 (15%)
Mito_carr 245..327 CDD:395101 21/85 (25%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 64/306 (21%)
Mito_carr 19..90 CDD:278578 20/68 (29%)
Mito_carr 104..201 CDD:278578 20/120 (17%)
Mito_carr 207..284 CDD:278578 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.