DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and PMP34

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:339 Identity:73/339 - (21%)
Similarity:125/339 - (36%) Gaps:88/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VGGAAEGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKSDVYKGMVDCA 83
            |.|||.|...:.|                         .:||..::::||::...|| :......
  Fly    20 VSGAAGGCIAMST-------------------------FYPLDTVRSRLQLEEAGDV-RSTRQVI 58

  Fly    84 MKIYRSEGVPGLYRGFW-ISSVQIVSGVFYISTYEGVRHVLNDLGAG------HRMKALAGGGCA 141
            .:|...||...||||.. :.....:|...|..|:    |.|..:.:|      ..:|.|..|..|
  Fly    59 KEIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTF----HALKAVASGGSPSQHSALKDLLLGSIA 119

  Fly   142 SLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINP------LGIKSWPGRSRLHISMDIGREIMR 200
            .::......||.|::..   |.|...||:..::|.      .|:|                .:..
  Fly   120 GIINVLTTTPFWVVNTR---LRMRNVAGTSDEVNKHYKNLLEGLK----------------YVAE 165

  Fly   201 RDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRIC---PVWVSHLFIQCVAGSLGGFTTT 262
            ::|..|.:.|...||| .|.|.|:.:..|.:.:..:.|..   ...:|..||..:|.:.    .|
  Fly   166 KEGIAGLWSGTIPSLM-LVSNPALQFMMYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAF----AT 225

  Fly   263 ILTNPLDIVRARLQVH-----------------RLDSMSVAFRELWQEEKLNCFFKGLSARLVQS 310
            :||.||.:|:.: |.|                 |.:|.......:.|.:.:...|:||.|:::|:
  Fly   226 VLTYPLQLVQTK-QRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQT 289

  Fly   311 AAFSFSIILGYETI 324
            ...:..:.:.||.|
  Fly   290 VLTAALMFMAYEKI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 18/79 (23%)
Mito_carr 132..238 CDD:395101 24/111 (22%)
Mito_carr 245..327 CDD:395101 23/97 (24%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 23/105 (22%)
Mito_carr 105..202 CDD:278578 24/116 (21%)
Mito_carr 214..303 CDD:278578 21/93 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441540
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.