DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Tpc2

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:367 Identity:81/367 - (22%)
Similarity:141/367 - (38%) Gaps:104/367 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESSSSTKSRLAVAPTGVGGAAEGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKT 65
            |.|:|...:...||.    ||.|..||  |||..                        ||.|:|.
  Fly     1 MPENSVVVQLMQAVG----GGIAGAAT--RTITQ------------------------PLDVLKI 35

  Fly    66 QLQVQ------HKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVS---GVFYISTYEGVRH 121
            :.|:|      ||...|:|::.....:|..||:.|::||.  :|.|::|   .:....:||.:|.
  Fly    36 RFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGH--NSGQVLSISYALVQFWSYEQLRS 98

  Fly   122 VLNDLGAGHRMKAL---AGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWP 183
            :.:..........|   ..||.|..:|.....||||:....:....|:.                
  Fly    99 MAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMVAADPSSR---------------- 147

  Fly   184 GRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRICP------V 242
             ||:::....: |::.:.:|:.|..||...:|:...|.....:.||......:....|      :
  Fly   148 -RSQMNTFTGL-RKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEI 210

  Fly   243 WVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSMSVAFRE------------------ 289
            ..:.||:.   |:|.|....::..|.|:::.|:|:       :||::                  
  Fly   211 HGAFLFLN---GALSGVLAKMIVYPADLLKKRIQL-------MAFKQERKTFGRNPECPTILGCI 265

  Fly   290 --LWQEEKLNCFFKGLSARLVQSAAFS---FSIILGYETIKR 326
              .::||.:..|:||:...|:::...|   |||   |:..||
  Fly   266 TTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSI---YDMFKR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 22/87 (25%)
Mito_carr 132..238 CDD:395101 21/108 (19%)
Mito_carr 245..327 CDD:395101 24/105 (23%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 70/339 (21%)
Mito_carr 23..99 CDD:278578 26/103 (25%)
Mito_carr 108..194 CDD:278578 21/103 (20%)
Mito_carr 216..307 CDD:278578 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.