DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Tyler

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:372 Identity:70/372 - (18%)
Similarity:127/372 - (34%) Gaps:134/372 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GGAAEGATYIRTIEWDMMNKT----------KFFPL---------SMLSSFSVRCCLFPLTVIKT 65
            ||..||.. :...|.|.:..|          :..|:         .::::|.|.    ||.|:||
  Fly    12 GGEEEGCR-LECKEMDPLRLTTLILSADPRYRIKPMQQVVSALVGGLITTFVVT----PLEVVKT 71

  Fly    66 QLQVQH-------------------------KSDV--------------YKGMVDCAMKIYRSEG 91
            ::|.||                         .||:              .:|.:|..:||..:.|
  Fly    72 RVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSG 136

  Fly    92 VPGLYRGFWISSVQ-IVSGVFYISTYEGVRHVLNDL-----------------GA---------- 128
            ..||:.|...:.|. :.|.:.|..|||.:::.|:.:                 ||          
  Fly   137 FSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLDQAT 201

  Fly   129 -GHRMKA--------------LAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLG 178
             |..:.|              :|.|.|:..:..|.|.|.:::.     :.|.:...:..::    
  Fly   202 RGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVR-----IKMQSEYMTYAEL---- 257

  Fly   179 IKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRICPVW 243
               |          .:.|.::|:.|..|.:||:..::|...|.|..:||.|    :.:.|...|.
  Fly   258 ---W----------RVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVY----EAIKRAFSVT 305

  Fly   244 VSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSMSVAFREL 290
            ........:.|::.|...|.:|.|.|::....|:..  ...|.:.|:
  Fly   306 EPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIEL--GQDVLYEEI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 27/118 (23%)
Mito_carr 132..238 CDD:395101 21/119 (18%)
Mito_carr 245..327 CDD:395101 9/46 (20%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 28/133 (21%)
Mito_carr 216..302 CDD:278578 21/111 (19%)
Mito_carr 306..429 CDD:278578 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.