DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Mpcp1

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:300 Identity:63/300 - (21%)
Similarity:119/300 - (39%) Gaps:56/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MLSSFSVRCCLFPLTVIKTQLQV---QHKSDVYKGM-VDCAMKIYRSEGVPGLYRGFWISSV--Q 105
            ::|..|....:.||.::|.:|||   ::|| |:.|. :..|     .|||.||.:| |..:.  .
  Fly    83 IISCGSTHTMVVPLDLVKCRLQVDPAKYKS-VFTGFRISLA-----EEGVRGLAKG-WAPTFIGY 140

  Fly   106 IVSGVFYISTYEGVRHVLND-LGAGHRM-----KALAGGGCASLVGQTIIVPFDVISQHAMVLGM 164
            .:.|:.....||..:.|..| :|..:..     ..||....|.......:.|.:...        
  Fly   141 SMQGLCKFGLYEVFKKVYGD
AIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAK-------- 197

  Fly   165 SAHAGSKGDINPLGIKSWPGRSR-LHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAF 228
                        :.|::.||.:: |..::.   ::..::|...||:|.....|..:|.:.|.:|.
  Fly   198 ------------VKIQTTPGFAKTLREALP---KMTAQEGVTAFYKGLVPLWMRQIPYTMMKFAC 247

  Fly   229 YHLYQDELFR-ICP------VWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARL-QVHRLDSMSV 285
            :....:.|:: :.|      .....|.:...||.:.|....|:::|.|.|.::| |.....::.|
  Fly   248 FERTLELLYKY
VVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDV 312

  Fly   286 AFRELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYETIK 325
            |.:..|     :..:.||..|:|.....:.:....|:.:|
  Fly   313 AKQLGW-----SGLWGGLVPRIVMIGTLTAAQWFIYDAVK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 24/83 (29%)
Mito_carr 132..238 CDD:395101 17/111 (15%)
Mito_carr 245..327 CDD:395101 18/81 (22%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 24/83 (29%)
Mito_carr <188..258 CDD:278578 14/92 (15%)
Mito_carr 273..350 CDD:278578 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.