DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and CG4995

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:272 Identity:61/272 - (22%)
Similarity:113/272 - (41%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PLTVIKTQLQVQH-KSDVYKGMVDCAMKIYRSEGVPGLYRGFWISS----VQIVSGVFYISTYEG 118
            |...:|..||... ::..|||...|...|.:.:...|||||  |||    :.:|:.:.: ..|..
  Fly    60 PFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRG--ISSPMGGIGLVNAIVF-GVYGN 121

  Fly   119 VRHVLNDLGA--GHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSK--GDINPLGI 179
            |:.:.||..:  .|    ...|..|.:....:..|.: :::..:.|.....:|.|  |.|:.|  
  Fly   122 VQRLSNDPNSLTSH----FFAGSIAGVAQGFVCAPME-LAKTRLQLSTQVDSGIKFTGPIHCL-- 179

  Fly   180 KSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWW-AFYHLYQDELFRICPVW 243
                            :.|::.:|.||.::|.||:::..:|..|.:: :|.:|.:.       |.
  Fly   180 ----------------KYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQ-------VE 221

  Fly   244 VSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRL----------DSMSVAFRELWQEEKLNC 298
            ...:....:||...|.::.:...|:|:|:..:|...|          |.....||    .|....
  Fly   222 TPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFR----NEGPQY 282

  Fly   299 FFKGLSARLVQS 310
            ||:||::.|:::
  Fly   283 FFRGLNSTLIRA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 20/70 (29%)
Mito_carr 132..238 CDD:395101 20/108 (19%)
Mito_carr 245..327 CDD:395101 17/76 (22%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 20/67 (30%)
PTZ00169 41..295 CDD:240302 61/272 (22%)
Mito_carr 128..218 CDD:278578 22/112 (20%)
Mito_carr 221..304 CDD:278578 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.