DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and CG9582

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:309 Identity:73/309 - (23%)
Similarity:134/309 - (43%) Gaps:75/309 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSSFSVRCCLFPLTVIKTQLQVQHKSD-----VYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIV 107
            ||.|....|..||.|:||::|:|....     ||...:|..:||||.||:..|::|. :..:.:.
  Fly    22 LSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGI-VPPICVE 85

  Fly   108 S----GVFYISTYEGVRHVLNDLGA------GHRMKALAGGGCASLVGQTIIVPFDVISQHAMVL 162
            :    |.|.:  ||.::... ..||      .|.|    .|..|:::...::.||:|:.     :
  Fly    86 TPKRGGKFLM--YESLKPYF-QFGAPQPTPLTHAM----SGSMAAILESFLVNPFEVVK-----I 138

  Fly   163 GMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGF--RGFYRGYTASLMAYVPNSAMW 225
            ...||.|.:       :|          ::.:.:.|::.||:  :|.|||.|| |:|  .|:...
  Fly   139 TQQAHRGKR-------LK----------TLSVVKYIIKHDGYGIKGLYRGITA-LVA--RNAVFH 183

  Fly   226 WAFYHLY----------QDELFRICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRL 280
            :.|:..|          :|:.:.|    :..:.|..:|.||    ..:::..||:.:.|:|..:.
  Fly   184 FGFFGFYNALKDIVPSPEDKTYNI----LRKVIIAGLASSL----ACVMSVTLDMAKCRIQGPQP 240

  Fly   281 DSMSVAF-------RELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYE 322
            ....|.:       :..::||.....||||.|.:::.......:::.||
  Fly   241 VKGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 26/85 (31%)
Mito_carr 132..238 CDD:395101 25/117 (21%)
Mito_carr 245..327 CDD:395101 18/85 (21%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 73/309 (24%)
Mito_carr 17..104 CDD:278578 26/85 (31%)
Mito_carr 109..196 CDD:278578 25/115 (22%)
Mito_carr 216..295 CDD:278578 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.