DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:346 Identity:74/346 - (21%)
Similarity:128/346 - (36%) Gaps:74/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YIRTIEWDMMNKTKFFPLSMLSSFSVR-----------------CCLFPLTVIKTQLQVQHKSDV 75
            ::|::|  :..:.:|.|.::....:.|                 .|:|||.|.||::||..:...
  Fly    10 HLRSLE--IEEEPRFPPTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAK 72

  Fly    76 YKGMVDCAMKIYRS--------EGVPGLYRGFWISSVQIVSGVFYISTYEGVRHVLND------L 126
            ..|.   ||..:|:        ||...||.||   |..:.....:.|    :|.||.|      |
  Fly    73 KTGK---AMPTFRATLTNMIRVEGFKSLYAGF---SAMVTRNFIFNS----LRVVLYDVFRRPFL 127

  Fly   127 GAGHR----MKALAGGGC---ASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPG 184
            ....|    :|.....||   |..:.|.:..|||::.......|.....|....:|         
  Fly   128 YQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVN--------- 183

  Fly   185 RSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRICPVWVSHLFI 249
             |.:...:|    |.||.|....::|...|.|.....:......|.:.:....|:..: ...|.:
  Fly   184 -SMVQAFVD----IYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDL-EEGLPL 242

  Fly   250 QCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSMSV---------AFRELWQEEKLNCFFKGLSA 305
            :.|:....|.|.::|:.|.|::::|:....:|....         ..|:|.:||.:...:|||..
  Fly   243 RFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMP 307

  Fly   306 RLVQSAAFSFSIILGYETIKR 326
            ...:...||....|..|.:::
  Fly   308 TWFRLGPFSVLFWLSVEQLRQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 25/103 (24%)
Mito_carr 132..238 CDD:395101 21/108 (19%)
Mito_carr 245..327 CDD:395101 20/91 (22%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 25/84 (30%)
Mito_carr 137..232 CDD:278578 21/108 (19%)
Mito_carr 237..329 CDD:278578 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.