DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Rim2

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:351 Identity:78/351 - (22%)
Similarity:141/351 - (40%) Gaps:69/351 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ESSSS--TKSRLAVAPTGVGGAAEGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTV--I 63
            :||::  |.|||  |....||.|.|.      :.:::...:   ...||:..:|....|..:  :
  Fly    37 QSSTAFMTPSRL--AENAGGGPANGG------QSELLRPEQ---RRKLSTTILRNRSQPQVIGGV 90

  Fly    64 KTQLQVQH---KSDVYKGM--VDCAMKIYRSEGVPGLYRGFWISSVQIV-SGVFYISTYEGVRHV 122
            :..:.:.|   .|...|.|  |.|...|.::||...|::|...:.|.:. |...|..||...::.
  Fly    91 RRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYSQTKNT 155

  Fly   123 LNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAG--SKGDINPLGIKSWPGR 185
            ||.||...|...|.                     |.|   .:|.||  |....||:    |..:
  Fly   156 LNSLGFVERDSPLV---------------------HIM---SAASAGFVSSTATNPI----WFVK 192

  Fly   186 SRLH------ISMDIGREIMR---RDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELF---- 237
            :|:.      :.|.:.:.|.|   :.|...||:|.|||... :..:.:.:..|...:.:|.    
  Fly   193 TRMQLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFG-ICETMVHFVIYEFIKSKLLEQRN 256

  Fly   238 -RICPVWVSHLFIQ-CVAGSLGGFTTTILTNPLDIVRARL--QVHRLDSMSVAFRELWQEEKLNC 298
             |......|..|:: .:||::.....:.:..|.::.|.||  :.::.:|.......:|:||....
  Fly   257 QRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNKYNSFWQTLHTVWKEEGRAG 321

  Fly   299 FFKGLSARLVQSAAFSFSIILGYETI 324
            .::||:.:||:....:..::..||.:
  Fly   322 LYRGLATQLVRQIPNTAIMMATYEAV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 21/86 (24%)
Mito_carr 132..238 CDD:395101 23/121 (19%)
Mito_carr 245..327 CDD:395101 18/83 (22%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 31/129 (24%)
Mito_carr 163..253 CDD:278578 24/118 (20%)
Mito_carr 268..355 CDD:278578 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.