DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and Ant2

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:337 Identity:76/337 - (22%)
Similarity:133/337 - (39%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GGAAEGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKS------DVYKG 78
            ||...|...:::...|.|       :..:|:...:..:.|:..:|..||||..|      ..|||
  Fly     6 GGGGHGKGDLKSFLMDFM-------MGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKG 63

  Fly    79 MVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTYEGVRHVLND------LGAGHRMKA--- 134
            :|||.::|.:.:|....:||      .:.:.:.|..| :.:.....|      ||...:.|.   
  Fly    64 IVDCFIRIPKEQGFSSFWRG------NLANVIRYFPT-QALNFAFKDVYKSVFLGGVDKHKQFWR 121

  Fly   135 -----LAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDI 194
                 ||.||.|.......:.|.|.....     ::|..|..|:....|:            :|.
  Fly   122 HFAGNLASGGAAGATSLCFVYPLDFARTR-----LAADVGKGGNREFNGL------------IDC 169

  Fly   195 GREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDEL--FRICPVWVSHLFIQCVAGSLG 257
            ..::::.||..|.|||:..|:...|...|.::.||...:|.|  .:..|.:||....|.|....|
  Fly   170 LMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAG 234

  Fly   258 GFTTTILTNPLDIVRARLQVHR-LDSMSVAFR---ELW----QEEKLNCFFKGLSARLVQSAAFS 314
                 |.:.|.|.||.|:.:.. |....:.::   ..|    ::|.:..||||..:.:::....:
  Fly   235 -----IASYPFDTVRRRMMMQSGLKKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGA 294

  Fly   315 FSIILGYETIKR 326
            ..:.| |:.:|:
  Fly   295 LVLAL-YDEMKK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 20/84 (24%)
Mito_carr 132..238 CDD:395101 26/115 (23%)
Mito_carr 245..327 CDD:395101 20/90 (22%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 72/326 (22%)
Mito_carr 17..111 CDD:278578 23/107 (21%)
Mito_carr 119..215 CDD:278578 25/112 (22%)
Mito_carr 218..307 CDD:278578 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.