DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and CG5254

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:316 Identity:71/316 - (22%)
Similarity:125/316 - (39%) Gaps:98/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CCLFPLTVIKTQLQVQ-------------HKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQI 106
            |.:.||.|:||::|:|             |    |.|:.||..|:||.||:...::|       |
  Fly    30 CIMQPLDVVKTRIQIQATPAPNAAALGEVH----YNGVFDCFAKMYRHEGISSYWKG-------I 83

  Fly   107 VSGVFYISTYEGVRHVLNDLGAGHRMKALAGGGCA-------SLVGQT-------IIVPFDVIS- 156
            :..:...:....::.::.:     :.|.|...|..       ||.|.|       .:.||:|:. 
  Fly    84 MPPILAETPKRAIKFLVFE-----QTKPLFQFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKV 143

  Fly   157 ------QHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASL 215
                  |..|   :|..|.:||.|...|:                       ||.|..:|.||::
  Fly   144 AQQADRQKKM---LSTFAVAKGIIQQDGL-----------------------GFSGLNKGITATM 182

  Fly   216 MAYVPNSAMWWAFYHLYQDELFRICPVW-VSHL-FIQCVA-GSLGGFTTTILTNPLDIVRARLQV 277
            ......:.:::.|||..::    :.|.: .||| |::.|. |.|.|.....:..|.|:.::|:|.
  Fly   183 GRNGVFNMVYFGFYHSVKN----VVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQG 243

  Fly   278 HR-----------LDSMSVAFRELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYE 322
            .:           |.||.:.:|    ||.....:|||..::::.......::|.:|
  Fly   244 PQPVPGQIKYRGTLSSMGIVYR----EEGFRALYKGLVPKIMRLGPGGAILLLVFE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 20/82 (24%)
Mito_carr 132..238 CDD:395101 27/126 (21%)
Mito_carr 245..327 CDD:395101 23/91 (25%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 22/97 (23%)
PTZ00169 19..301 CDD:240302 71/316 (22%)
Mito_carr 122..207 CDD:278578 24/114 (21%)
Mito_carr 209..305 CDD:278578 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.