DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asp and CG13544

DIOPT Version :9

Sequence 1:NP_524488.3 Gene:asp / 42946 FlyBaseID:FBgn0000140 Length:1954 Species:Drosophila melanogaster
Sequence 2:NP_611761.1 Gene:CG13544 / 37673 FlyBaseID:FBgn0034826 Length:367 Species:Drosophila melanogaster


Alignment Length:382 Identity:84/382 - (21%)
Similarity:156/382 - (40%) Gaps:73/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   908 TRQLRVPAISRLQRIFNVKLALGALGEANFQL-----GGDIAAQDIVDGHREKTLSLLWQLIYKF 967
            ||:..|| :....|..|.:..:|:...:|.:|     .|.:.. |.......:|:...|:..| |
  Fly    12 TRRATVP-LGGDSRSGNTESQIGSSKSSNCRLHLISRTGKLLL-DYKQYKAARTIQNNWRKFY-F 73

  Fly   968 RS--PKFHAAATVLQKWWR------RHWLHV--VIQRRIRHKELMRRHRAATVIQAVFRGHQMRK 1022
            |.  .....|...:|:|||      .|:.:|  ::|:|::.    ..|||||.|||:|||.:.|:
  Fly    74 RKYFKDLRKAVITIQRWWRGFSVRKNHFRYVENLLQKRVQD----HHHRAATKIQALFRGWKSRR 134

  Fly  1023 YV----KLFKTERTQAAIILQ--KFTRRYLAQKQLYQSYHSIITIQRWWRAQQL----------G 1071
            .:    ||.:.:...|..:|.  .|...:|.:.......:|:.......|.::|          |
  Fly   135 TIHDHSKLLRKQVCAAEDLLNCVAFKLHHLLRTFAIPGVYSLKNSNCMSRVEKLLASLHFRFHNG 199

  Fly  1072 RQHRQRFVELREAAIFLQRIWRRRLFAKKLLAAAETARLQRSQKQQAAASYIQMQWRSYQLGRIQ 1136
            |...|...||.:.....:...|...|:|   ...|.||.....|.:..|: ::|.      ..|:
  Fly   200 RVKTQLAKELADRGKDTETFKRSNKFSK---VPFEGARYWSQCKPKCEAA-LKMS------KNIE 254

  Fly  1137 RQQFLRQRDLIMFVQRRMRSKWSMLEQRKEFQQLKRAAINIQQRWRAKLSMRKCNADYLALRSSV 1201
            |:.:   |.:.::...:..:..:::|:.:.:::.|....||::  .|:.|.|....|.:|     
  Fly   255 RRMY---RIIEIYDASQREAHAALVEKNRAYRKHKGLMQNIKK--SAEKSKRDFCGDVIA----- 309

  Fly  1202 LKVQAYRKATI----QMRIDRNHYYSLRKNVICLQQRLRAIMKMREQREN---YLRL 1251
                :.|:..|    .:.:|:|.:    ||...|::.:..|.:...:.||   |.|:
  Fly   310 ----SMRRWKILVDNDLTVDKNIF----KNPQNLERFVAEISQYANEFENCTCYCRI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aspNP_524488.3 ASH 26..122 CDD:292408
CH 866..968 CDD:237981 14/64 (22%)
TPH 1066..1435 CDD:290579 40/203 (20%)
IQ 1689..1711 CDD:197470
CG13544NP_611761.1 COG5022 <12..>301 CDD:227355 69/310 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8171
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22706
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.