DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asp and pigs

DIOPT Version :9

Sequence 1:NP_524488.3 Gene:asp / 42946 FlyBaseID:FBgn0000140 Length:1954 Species:Drosophila melanogaster
Sequence 2:NP_001245550.1 Gene:pigs / 31596 FlyBaseID:FBgn0029881 Length:977 Species:Drosophila melanogaster


Alignment Length:559 Identity:114/559 - (20%)
Similarity:175/559 - (31%) Gaps:194/559 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LNPSDDDIEVKVMKAIREEHNLSLEWMEHTVPARDEVSMELVWSP-----VLEVACKETLQLIDN 115
            ::|||:..| |....|.||.:|:.:..|     .|:....:...|     :|..|.|.:.:...:
  Fly   587 ISPSDEPAE-KATTDILEEEDLNGQDRE-----EDQEDYSVCDGPQSLPAILSGAHKLSDKFEQS 645

  Fly   116 RNF--RKEVMIILKSKSNQPVKNPRKFPTVGKTLQLKSPTGAGKTMKSV-------VSAAVQQKK 171
            ..|  ..|:.:.:....:|.|.|....||...:...:||. |.:..:|:       ...::|...
  Fly   646 GVFITDDEITVDIAKTEDQSVANTMGNPTPNLSKIPRSPL-AQRRRRSIDNSTCGGAGGSLQDLS 709

  Fly   172 RMSAAAAP--PSKQTWRVTAPSRPAAWAHPPPQAPLVEKNVYKTPQEEPVYISPQPRSLKENLSP 234
            ..|...||  ..||....:..:|.:..|...|.||         |:.......|..|.:....|.
  Fly   710 SRSGLPAPAFSRKQPVYRSVRTRNSTGATTTPVAP---------PRSRQATQLPMVRDVTNTWSG 765

  Fly   235 MTPGNLLDVIDNLRFTPLT------ETRGKGQATIFPDNLAAWPTPTLKGNVKSCANDMRPRRIT 293
            .|.|      ...|..|.|      .|.|.|.|..|..|        .||.......|...||:.
  Fly   766 RTTG------APKRRPPCTADTFVAPTNGTGPAGSFERN--------GKGRSSQILYDSNGRRVR 816

  Fly   294 PDDLEDQPATNKTFDVKHSETINISLDTLDCSRIDGQPHTPLNKTTTIV--HATHTRALACIHEE 356
                                              .|.|....:.||:.|  ||:           
  Fly   817 ----------------------------------SGAPGCTSSLTTSPVKNHAS----------- 836

  Fly   357 EGPSPPRTPTKSAIHDLKRDIKLVGSPLRKYSESMKDLSLLSPQTKYAIQGSMPNLNEMKIRSIE 421
               ||.......|....|.|.:::        |.||  ||||   :||..      |:.|     
  Fly   837 ---SPLAQQLLEAASSAKNDAQIL--------EKMK--SLLS---RYAAG------NQTK----- 874

  Fly   422 QNRYYQEQQIQIKAKDLNSSSSSEASLAGQQEFLFNHSEILAQSSRFNLHEVGRKSVKGSPVKNP 486
                                       ||                      ||..:...:.:.:.
  Fly   875 ---------------------------AG----------------------VGATATAANKINSN 890

  Fly   487 HKRRSHELSFSDA--PSNESLYRNETVAISPPKKQRVEDTTLPRSAAPANASARSSSAHAWPHAQ 549
            .|:......|:.|  .||.:|.|:|  :.|||.|.|.:     ||:|.::..:.:|:|.|...| 
  Fly   891 GKKTPVYEDFTTAWVHSNGNLERSE--SCSPPAKARSK-----RSSAASSCESNNSNAGAGSGA- 947

  Fly   550 SKKFKLAQTMSLMKKPATPRKVRDTSIQPSVKLYDSELY 588
                 .|.:.|::    :||:.|..|..|:...:.:|||
  Fly   948 -----AAGSASVV----SPRRERGMSKIPAPVRHHTELY 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aspNP_524488.3 ASH 26..122 CDD:292408 16/72 (22%)
CH 866..968 CDD:237981
TPH 1066..1435 CDD:290579
IQ 1689..1711 CDD:197470
pigsNP_001245550.1 CH 22..159 CDD:237981
GAS2 258..325 CDD:280367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.