DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and he1.3

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001091658.1 Gene:he1.3 / 792176 ZFINID:ZDB-GENE-040518-1 Length:271 Species:Danio rerio


Alignment Length:198 Identity:66/198 - (33%)
Similarity:108/198 - (54%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 KERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKN-CGCCS 205
            |:.:.::..:||.:.:.:|....::.::||....|.|||:||.|.....    |.:::| .||.:
Zfish    77 KKNSSNFVEVPYIVSSEYSATEISVIQKAMSGIHNKTCIRFVPRISQTD----YISIENQDGCFA 137

  Fly   206 FLGKNGNGRQPISI-GRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDV 269
            |:|||| |:|.:|: .:.|....|:.|||.|.:||:|||.|.|||.:|.|:...|...:..||  
Zfish   138 FIGKNG-GKQLVSLRKKGCVYHSIVQHELNHALGFYHEHVRSDRDSYITIHWEYIATNEIRNF-- 199

  Fly   270 LSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLL 334
             ..:..:.....||..|||||.|.:|:.....:|:||.   |...:.:|:.|.:|..||::.|::
Zfish   200 -MKKNTNSQNTTYDYGSIMHYGKTAFTTVKGKETMTPY---PDETVPIGKAKEMSDIDILRINMM 260

  Fly   335 YKC 337
            |.|
Zfish   261 YSC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 66/198 (33%)
Astacin 144..339 CDD:279708 65/196 (33%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
he1.3NP_001091658.1 ZnMc 82..263 CDD:294052 64/191 (34%)
Astacin 86..264 CDD:279708 65/189 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.