Sequence 1: | NP_524487.2 | Gene: | tld / 42945 | FlyBaseID: | FBgn0003719 | Length: | 1067 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001091658.1 | Gene: | he1.3 / 792176 | ZFINID: | ZDB-GENE-040518-1 | Length: | 271 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 66/198 - (33%) |
---|---|---|---|
Similarity: | 108/198 - (54%) | Gaps: | 13/198 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 KERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKN-CGCCS 205
Fly 206 FLGKNGNGRQPISI-GRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDV 269
Fly 270 LSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLL 334
Fly 335 YKC 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tld | NP_524487.2 | ZnMc_BMP1_TLD | 137..338 | CDD:239808 | 66/198 (33%) |
Astacin | 144..339 | CDD:279708 | 65/196 (33%) | ||
CUB | 388..474 | CDD:214483 | |||
CUB | 478..586 | CDD:278839 | |||
FXa_inhibition | 595..630 | CDD:291342 | |||
CUB | 634..750 | CDD:278839 | |||
FXa_inhibition | 757..792 | CDD:291342 | |||
CUB | 797..906 | CDD:278839 | |||
CUB | 910..1023 | CDD:278839 | |||
he1.3 | NP_001091658.1 | ZnMc | 82..263 | CDD:294052 | 64/191 (34%) |
Astacin | 86..264 | CDD:279708 | 65/189 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |