Sequence 1: | NP_524487.2 | Gene: | tld / 42945 | FlyBaseID: | FBgn0003719 | Length: | 1067 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001036784.1 | Gene: | c6ast1 / 751088 | ZFINID: | ZDB-GENE-070621-1 | Length: | 260 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 76/195 - (38%) |
---|---|---|---|
Similarity: | 109/195 - (55%) | Gaps: | 23/195 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 IPYEIDTIFSGAHKALFKQAMRHWENFTCIKF----VERDPNLHANYIYFTVK-NCGCCSFLGKN 210
Fly 211 GNGRQPISIGRN-CEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEE 274
Fly 275 VDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCAS 339
Fly 340 339 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tld | NP_524487.2 | ZnMc_BMP1_TLD | 137..338 | CDD:239808 | 74/192 (39%) |
Astacin | 144..339 | CDD:279708 | 75/193 (39%) | ||
CUB | 388..474 | CDD:214483 | |||
CUB | 478..586 | CDD:278839 | |||
FXa_inhibition | 595..630 | CDD:291342 | |||
CUB | 634..750 | CDD:278839 | |||
FXa_inhibition | 757..792 | CDD:291342 | |||
CUB | 797..906 | CDD:278839 | |||
CUB | 910..1023 | CDD:278839 | |||
c6ast1 | NP_001036784.1 | Astacin | 71..259 | CDD:279708 | 75/193 (39%) |
ZnMc_hatching_enzyme | 77..257 | CDD:239810 | 74/191 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |