DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and c6ast1

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:195 Identity:76/195 - (38%)
Similarity:109/195 - (55%) Gaps:23/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IPYEIDTIFSGAHKALFKQAMRHWENFTCIKF----VERDPNLHANYIYFTVK-NCGCCSFLGKN 210
            :||.|...:|...|.:..|..|..|..||::|    .:||        |..:: |.||.||:|:.
Zfish    82 VPYIISDEYSTQEKDVIFQGFRSLEKSTCVRFRPRTTQRD--------YINIEPNSGCYSFVGRR 138

  Fly   211 GNGRQPISIGRN-CEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEE 274
             .|.|.:|:..: |.|..|:.|||.||:||||||.|.|||.|:.|...||:.|||.|||.:....
Zfish   139 -TGGQTVSLDHDGCIKLNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIPGQERNFDKIKTNN 202

  Fly   275 VDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCAS 339
            ::   ..||.:|:|||.:.:|||:... ||.||   |.:.:.:|:.||:|..||::.|.|| |:|
Zfish   203 LE---TAYDYSSVMHYGRFAFSKNKEA-TIVPI---PDSGVTIGRAKRMSSNDILRINRLY-CSS 259

  Fly   340  339
            Zfish   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 74/192 (39%)
Astacin 144..339 CDD:279708 75/193 (39%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 75/193 (39%)
ZnMc_hatching_enzyme 77..257 CDD:239810 74/191 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.