Sequence 1: | NP_524487.2 | Gene: | tld / 42945 | FlyBaseID: | FBgn0003719 | Length: | 1067 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009046.2 | Gene: | TNFAIP6 / 7130 | HGNCID: | 11898 | Length: | 277 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 55/207 - (26%) |
---|---|---|---|
Similarity: | 81/207 - (39%) | Gaps: | 44/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 743 RSGFVAKFVIDVDE----CSMNNGGC----QHRCRNTFGSYQCSC------RNGYTLAENGHNC- 792
Fly 793 --------------------------TETRCKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVL 831
Fly 832 GHRIQLTFHDFEVESHQECIYDYVAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAG 896
Fly 897 LQRKGFKATFVS 908 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tld | NP_524487.2 | ZnMc_BMP1_TLD | 137..338 | CDD:239808 | |
Astacin | 144..339 | CDD:279708 | |||
CUB | 388..474 | CDD:214483 | |||
CUB | 478..586 | CDD:278839 | |||
FXa_inhibition | 595..630 | CDD:291342 | |||
CUB | 634..750 | CDD:278839 | 3/6 (50%) | ||
FXa_inhibition | 757..792 | CDD:291342 | 9/44 (20%) | ||
CUB | 797..906 | CDD:278839 | 38/108 (35%) | ||
CUB | 910..1023 | CDD:278839 | |||
TNFAIP6 | NP_009046.2 | Link_domain_TSG_6_like | 36..128 | CDD:239592 | 16/87 (18%) |
CUB | 135..244 | CDD:278839 | 38/108 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |