Sequence 1: | NP_524487.2 | Gene: | tld / 42945 | FlyBaseID: | FBgn0003719 | Length: | 1067 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035333.2 | Gene: | tnfaip6 / 678516 | ZFINID: | ZDB-GENE-060421-2654 | Length: | 271 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 56/204 - (27%) |
---|---|---|---|
Similarity: | 84/204 - (41%) | Gaps: | 45/204 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 757 CSMNNGGC----QHRCRNTFGSYQCSC------RNGYTLAENGHNC------------------- 792
Fly 793 TETRCKFEITTSYG--------VLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQE 849
Fly 850 CIYDYVAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQRKGFKATFVSECGGYL 914
Fly 915 RATNHSQTF 923 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tld | NP_524487.2 | ZnMc_BMP1_TLD | 137..338 | CDD:239808 | |
Astacin | 144..339 | CDD:279708 | |||
CUB | 388..474 | CDD:214483 | |||
CUB | 478..586 | CDD:278839 | |||
FXa_inhibition | 595..630 | CDD:291342 | |||
CUB | 634..750 | CDD:278839 | |||
FXa_inhibition | 757..792 | CDD:291342 | 9/44 (20%) | ||
CUB | 797..906 | CDD:278839 | 40/116 (34%) | ||
CUB | 910..1023 | CDD:278839 | 4/14 (29%) | ||
tnfaip6 | NP_001035333.2 | Link_domain_TSG_6_like | 46..138 | CDD:239592 | 11/69 (16%) |
CUB | 145..254 | CDD:278839 | 39/108 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |