DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and tnfaip6

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:204 Identity:56/204 - (27%)
Similarity:84/204 - (41%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 CSMNNGGC----QHRCRNTFGSYQCSC------RNGYTLAENGHNC------------------- 792
            |:...|..    |.......|.:.|:.      |.||.:.:.|.||                   
Zfish    68 CNFEGGTLATFDQLEAARQIGFHVCAAGWLDKGRVGYPIVKAGSNCGFGKVGIIDYGYRLNKSER 132

  Fly   793 TETRCKFEITTSYG--------VLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQE 849
            .:..|...:....|        ||.||.||::|.....||||.:...||||:|.|.||::|...:
Zfish   133 WDVYCYNPVAKECGGVHTDPEKVLVSPGYPDEYQDEQICYWHIRVRFGHRIRLHFLDFDIEEDTD 197

  Fly   850 CIYDYVAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQRKGFKATFVSECGGYL 914
            |:.|::.|||...:.|..:|.|||.:.|...|::.|.|.:...:|:.:...|||..::|      
Zfish   198 CLSDHLEIYDSYDDVSGFVGRYCGDQLPDDFISTGNVMTLKFLSDSSVTAGGFKLQYIS------ 256

  Fly   915 RATNHSQTF 923
              .|.||.|
Zfish   257 --VNSSQLF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342 9/44 (20%)
CUB 797..906 CDD:278839 40/116 (34%)
CUB 910..1023 CDD:278839 4/14 (29%)
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 11/69 (16%)
CUB 145..254 CDD:278839 39/108 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.