DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and pcolcea

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001025352.2 Gene:pcolcea / 563867 ZFINID:ZDB-GENE-041014-370 Length:479 Species:Danio rerio


Alignment Length:277 Identity:82/277 - (29%)
Similarity:130/277 - (46%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 CGGDLKLTKDQSIDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFELEKHDGCAYDFVEIRDG 542
            ||||| :.....:.|..:|..|.|:.:|.|.||.|:.:.|.|.|:.|:||....|.||:|::.:|
Zfish    35 CGGDL-VGDSGFVGSEGFPSFYKPNSKCTWYITVPEGNVVMLSFRIFDLEADPLCRYDYVDVYNG 98

  Fly   543 NHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAAL---MLDVDECKFTDHGCQH 604
            :.:..:.:|||||...|..:.:.||.|.:..||||.....||.|..   ...|||.:|       
Zfish    99 HSNMVQKLGRFCGTFRPGALISTSNTMMVEMVSDSGTGGRGFVAYFNGGKPHVDEHQF------- 156

  Fly   605 LCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPDV-YPNSKQCVWEVVA 668
                                         |||.:  |||.|::.:|::|:. ||....|.|.:..
Zfish   157 -----------------------------CGGKL--TKSQGTIKTPNWPEKNYPPGISCSWLITV 190

  Fly   669 PPNHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSILRL 733
            .|...:.:.|..||||..    |.|.:||:..::....:..::||.|||:..|..:.:..::|.:
Zfish   191 EPEMVIEVKFDKFDLESD----TYCRFDYVAFFNGGEKDDSRRIGKYCGYTAPQNIVTNSNVLLV 251

  Fly   734 EFYSDRTVQRSGFVAKF 750
            :|.||.:|...||:|.:
Zfish   252 QFVSDLSVTSDGFMASY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839 40/107 (37%)
FXa_inhibition 595..630 CDD:291342 1/34 (3%)
CUB 634..750 CDD:278839 37/116 (32%)
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
pcolceaNP_001025352.2 CUB 35..144 CDD:238001 41/109 (38%)
CUB 157..270 CDD:238001 37/118 (31%)
NTR_PCOLCE 355..479 CDD:239631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.