DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and c6ast3

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001013544.1 Gene:c6ast3 / 541399 ZFINID:ZDB-GENE-050320-99 Length:255 Species:Danio rerio


Alignment Length:193 Identity:63/193 - (32%)
Similarity:102/193 - (52%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IPYEIDTIFSGAHKALFKQAMRHWENFTCIKFV----ERDPNLHANYIYFTVKN-CGCCSFLGKN 210
            :||.|...:|.....:.::.:..:...|||:|.    |||        |.:::: .||.|::|:.
Zfish    79 VPYVIANHYSSRELEIIQRGLDSFSYSTCIRFFPRGNERD--------YISIESRSGCYSYVGRQ 135

  Fly   211 GNGRQPISIGRN-CEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEE 274
            |.. |.:|:.|: |.....:.|||.|.:||:||..|.|||.||.:...||:...:|||:.::...
Zfish   136 GYA-QTVSLARSGCLYHSTVQHELLHALGFNHEQTRNDRDNHIQVIWENILDDMKYNFNKVNTLN 199

  Fly   275 VDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKC 337
            ..   .|||.:|:|.|.:.:|||:. |.|:.||   |..:..||....:|:.||::.|.||:|
Zfish   200 QG---TPYDYSSVMQYERYAFSKNG-LPTMIPI---PNNNAALGTSTEMSQNDIIRINRLYQC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 63/193 (33%)
Astacin 144..339 CDD:279708 63/193 (33%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
c6ast3NP_001013544.1 Astacin 68..255 CDD:279708 62/191 (32%)
ZnMc 74..255 CDD:294052 62/191 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.