DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and pcolce2

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001005804.1 Gene:pcolce2 / 448281 XenbaseID:XB-GENE-1015978 Length:416 Species:Xenopus tropicalis


Alignment Length:329 Identity:95/329 - (28%)
Similarity:155/329 - (47%) Gaps:64/329 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 CGGDLKLTKDQSI-DSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFELEKHDGCAYDFVEIRD 541
            |||:  ||.|..: .|..:|..|.|:.:|.|:||.|:...|.|.|:..:||..:.|.||||::.:
 Frog    34 CGGN--LTGDTGVLGSEGFPGVYPPNSKCTWKITVPEGKVVVLSFRFIDLESDNLCRYDFVDVYN 96

  Fly   542 GNHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAALMLDVDECKFTDHGCQHLC 606
            | ||:...||||||...|..:.:.||:|.::.:||::....||.|..    ...:..:.|.|:  
 Frog    97 G-HSNVHRIGRFCGTFRPGALVSNSNKMLVQMISDANTAGNGFIAVF----SAAEPNERGDQY-- 154

  Fly   607 INTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPD-VYPNSKQCVWEVVAPP 670
                                       |||.:|  |.:||..:|::|: .||....|.|.:|||.
 Frog   155 ---------------------------CGGRLD--KPSGSFQTPNWPERDYPAGVTCSWHIVAPK 190

  Fly   671 NHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSILRLEF 735
            :..:.|.|..||:|  |.:|  |.|||:.:::....|..|:||.:||...|..:.||::.|.::|
 Frog   191 HQVIELKFEKFDVE--RDNY--CRYDYVAVFNGGEINDAKRIGKFCGDSPPAPIVSERNELLIQF 251

  Fly   736 YSDRTVQRSGFVAKF-----------VIDVDECSMNNGG-------CQHRCRNTFGSYQCS-CRN 781
            .||.::...||.|.:           |..:...:.....       ||.:|:.| |:.:.: |.:
 Frog   252 LSDLSLTADGFKAHYRFRPKKLPTTTVSPITTPAATTPSLKPTLALCQQKCKRT-GTLESNYCSS 315

  Fly   782 GYTL 785
            .:.:
 Frog   316 NFVI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839 42/108 (39%)
FXa_inhibition 595..630 CDD:291342 2/34 (6%)
CUB 634..750 CDD:278839 43/116 (37%)
FXa_inhibition 757..792 CDD:291342 6/37 (16%)
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
pcolce2NP_001005804.1 CUB 34..144 CDD:238001 43/116 (37%)
CUB 155..266 CDD:366096 43/116 (37%)
NTR_PCOLCE 293..416 CDD:239631 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.