Sequence 1: | NP_524487.2 | Gene: | tld / 42945 | FlyBaseID: | FBgn0003719 | Length: | 1067 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609758.1 | Gene: | CG15253 / 34916 | FlyBaseID: | FBgn0028948 | Length: | 253 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 62/196 - (31%) |
---|---|---|---|
Similarity: | 95/196 - (48%) | Gaps: | 8/196 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 WDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKN 210
Fly 211 GN----GRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLS 271
Fly 272 PEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYK 336
Fly 337 C 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tld | NP_524487.2 | ZnMc_BMP1_TLD | 137..338 | CDD:239808 | 62/196 (32%) |
Astacin | 144..339 | CDD:279708 | 62/196 (32%) | ||
CUB | 388..474 | CDD:214483 | |||
CUB | 478..586 | CDD:278839 | |||
FXa_inhibition | 595..630 | CDD:291342 | |||
CUB | 634..750 | CDD:278839 | |||
FXa_inhibition | 757..792 | CDD:291342 | |||
CUB | 797..906 | CDD:278839 | |||
CUB | 910..1023 | CDD:278839 | |||
CG15253 | NP_609758.1 | Astacin | 55..250 | CDD:279708 | 62/196 (32%) |
ZnMc_astacin_like | 59..246 | CDD:239807 | 58/190 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444932 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |