DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and CG15254

DIOPT Version :10

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_609757.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster


Alignment Length:196 Identity:58/196 - (29%)
Similarity:100/196 - (51%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 WDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKN 210
            |...::.|.|:......|:....:.:|..|..:|:.|.|...: ...|:..|.:..||.|::|..
  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTD-QEYYVNVTSEAGGCYSYVGYR 122

  Fly   211 GN----GRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLS 271
            ..    ..|..::...|.:.|.|:||..|.:||:|:.:..:||.::.|.:.||..|.|.||:...
  Fly   123 NRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYD 187

  Fly   272 PEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYK 336
            .|.|:....|||.:|::||...:|||:..: ||.|  :..|....:|||.::::.||.:.|::||
  Fly   188 NETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVP--LQEGAEELMGQRLQMTQSDINKLNVMYK 249

  Fly   337 C 337
            |
  Fly   250 C 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 58/196 (30%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:395345
FXa_inhibition 595..630 CDD:464251
CUB 634..750 CDD:395345
FXa_inhibition 757..792 CDD:464251
CUB 797..906 CDD:395345
CUB 910..1023 CDD:395345
CG15254NP_609757.1 ZnMc_astacin_like 61..248 CDD:239807 54/190 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.