DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and Semp1

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:238 Identity:68/238 - (28%)
Similarity:110/238 - (46%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DVLQHSHSPTLNGQPIQRRRRAVTVRKERTWDYGVIPYEI-DTIFSGAHKALFKQAMRHWENFTC 179
            ::|...:...:...||  |.|...|.:...|....:||.| |..|:.:|.....:|:...|..:|
  Fly    25 ELLAGFYQGDIKAHPI--RTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSC 87

  Fly   180 IKFVERDPNLHANY---IYFTVKNCGCCS-FLGKNGNGRQPIS-----IGRNCEKFGIIIHELGH 235
            :.|   .|....::   :..|.|..||.: .||.. |..|.::     :|..|.:.|.|||||.|
  Fly    88 VIF---KPATEMDFPMALVITSKGLGCNTVHLGYR-NKTQVVNLEIYPLGEGCFRIGSIIHELLH 148

  Fly   236 TIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPE------EVDLPLLPYDLNSIMHYAKNS 294
            .:||.|:|...:||:::.|...||  ..:||.:.::.:      :.|   ..||..|:|||...:
  Fly   149 VLGFEHQHVSQNRDQYVSIQWKNI--NPQYNINFVNNDNSTAWHDFD---EGYDYESVMHYVPRA 208

  Fly   295 FSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKC 337
            ||::.. .||.|  :..|.. .:|||..:|..||.:.|.:|:|
  Fly   209 FSRNGQ-PTIVP--LREGAE-NMGQRFYMSEKDIRKLNKMYRC 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 63/217 (29%)
Astacin 144..339 CDD:279708 62/210 (30%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
Semp1NP_609756.1 Astacin 53..249 CDD:279708 62/208 (30%)
ZnMc_astacin_like 55..245 CDD:239807 59/202 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.