DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and CG6696

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster


Alignment Length:309 Identity:82/309 - (26%)
Similarity:140/309 - (45%) Gaps:50/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SHKSQNKAALR----LPPPFLWTDDAVDVLQHSHSPTLN------------------GQPIQRRR 135
            |..:..||.||    :||...|..: :.:|:..:||..|                  |..:..|.
  Fly    29 STPATRKALLRARPAVPPAARWGAN-MQMLRRHNSPAFNFWTEDSDTNIWEHCGLFEGDIMLHRE 92

  Fly   136 --RAVTVRKERTWDYGVIPYEID-TIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFT 197
              |...:.:..||....:|:.|| ..|:.....:..:|.:.:.:.|||:|   .|....:..:..
  Fly    93 LLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRF---RPYEQGDKHWLL 154

  Fly   198 VKN--CGCCSFLGKNGNGRQPISIGR-NCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNI 259
            :|.  .||.|.:|:...| |.:::.. .|...|:::|||.|.:||:|:.:..:||:::.||..||
  Fly   155 IKGNYSGCWSSVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENI 218

  Fly   260 MRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLS 324
            :.|..:||:..:...:....:.||..|:|||:..:|||:... ||.|:    ..:..||||:.||
  Fly   219 LDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKA-TIEPL----DPYASLGQRRGLS 278

  Fly   325 RGDIVQANLLYKCASCGRTYQQNSGHIVSPHFIYSGNGV---LSEFEGS 370
            ..|:.:.|.:|: ..|...|..|        |...||.:   |..|:|:
  Fly   279 DKDVSKLNEMYE-QDCSEDYLLN--------FDRFGNYIDELLDYFQGN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 58/204 (28%)
Astacin 144..339 CDD:279708 58/198 (29%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
CG6696NP_573318.1 Astacin 104..295 CDD:279708 59/200 (30%)
ZnMc_astacin_like 110..289 CDD:239807 55/187 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.