DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and Adgrg6

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:299 Identity:73/299 - (24%)
Similarity:117/299 - (39%) Gaps:73/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 CKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQECIYDYVAIYDGR 861
            |:..::...|...||.||.|||....|.|..:...|:.||:||:||::|....||||.:::.:|.
  Rat    41 CRLVLSNPSGTFTSPCYPNDYPNTQSCSWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGE 105

  Fly   862 SENSSTLGIYCGG-REPYAVIASTNEMFMVLATDAGLQRKGFKATFVSECGGYLRATNHSQTFYS 925
            |:..     :||. .:..:..:|.|||.:..::|..:|:|||.|:::.     :..:..:|... 
  Rat   106 SQTK-----FCGATAKGLSFNSSVNEMHVSFSSDFSIQKKGFNASYIR-----VAVSLRNQKVI- 159

  Fly   926 HPRYGSRPYKRNMYCDWRIQADPESSVKIRFLH-----FEIEYSERCDYDY-------------- 971
                  .|...:.|     |.....|:.|..|.     ||.......|.|:              
  Rat   160 ------LPQTLDAY-----QVSVAKSISIPELKAFTLCFEASKVGNEDDDWTAFSYSDKSLTQLL 213

  Fly   972 -LEITEEGYSMNTIHGRFC-------GKHKPPIIISNSDTLLLRFQTDESNSLRGFAISFM---- 1024
             ||....||.: :|.|..|       .|.|..|...|.:.|.|.:    :||.....|:|.    
  Rat   214 SLEKANNGYFL-SISGARCLLNNALPVKEKEDIFTGNFEQLCLVW----NNSWGSVGINFKKNYE 273

  Fly  1025 ---------AVDPPEDS--VGEDFDAVTPFPGYLKSMYS 1052
                     .|.|.:.:  :|.|.|.:....|   |:|:
  Rat   274 TIPCDLTIGTVVPGDGTLLLGSDRDEIASLKG---SVYN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839 37/109 (34%)
CUB 910..1023 CDD:278839 27/139 (19%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001 37/109 (34%)
LamG 178..337 CDD:304605 30/140 (21%)
GPS 799..844 CDD:280071
7tm_4 861..1108 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.