DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and Astl

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001099974.1 Gene:Astl / 296129 RGDID:1562279 Length:436 Species:Rattus norvegicus


Alignment Length:411 Identity:112/411 - (27%)
Similarity:169/411 - (41%) Gaps:106/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VGALWMMMFFLVDYAEGRRLSQLPESECDFDFKEQPEDFFGILDSSLVPPKEPKDDIYQLKTTRQ 84
            ||:||..|..|:... |..|.....|.|.           |:..:|:.....|:           
  Rat     4 VGSLWPWMLTLLSLT-GLILGAPSASRCS-----------GVCSTSVPEGFTPE----------- 45

  Fly    85 HSGRRRKQSH--KSQNKAALRLPPP---FLWTDDAVDVLQHSHSPTLNGQPIQRRRRAVTVRKER 144
              |.|..|..  .:.|:..:....|   ||...|.:             :|...|..:||..|  
  Rat    46 --GSRVSQDKDIPAINQGLISEETPESSFLVEGDII-------------RPSPFRLLSVTNNK-- 93

  Fly   145 TWDYGV-----IPYEIDTIFSGAHKALFKQAMRHWENFTCIKFV----ERDPNLHANYIYFTVKN 200
             |..||     ||:.:.:.:....:.:..:|...:|.||||:||    :||       ....:..
  Rat    94 -WPKGVDGIVEIPFLLSSKYDEPSRQVIMEAFAEFERFTCIRFVAYRGQRD-------FVSILPM 150

  Fly   201 CGCCSFLGKNGNGRQPISIGRNC--EKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQ 263
            .||.|.:|::| |.|.:|:...|  :..||::|||.|.:||.|||:|.|||::|.:|...|:.|.
  Rat   151 AGCFSGVGRSG-GMQVVSLAPTCLQKGRGIVLHELMHVLGFWHEHSRADRDRYIRVNWNEILPGF 214

  Fly   264 EYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFS--KSPYLDTITPIGIPPGTHLELGQRKRLSRG 326
            |.||  :.....:: |.|||.:|:|||.:.:||  ..|   ||.|:..   :.:.:|||..||..
  Rat   215 EINF--IKSRNSNM-LAPYDYSSVMHYGRFAFSWRGQP---TIIPLWT---SSVHIGQRWNLSTS 270

  Fly   327 DIVQANLLYKCA-----SCGRTYQQNS-GHIVSPHFI-----------------------YSGNG 362
            ||.:...||.|:     |.||.::..| |...:|..|                       ..|.|
  Rat   271 DITRVCRLYSCSPSVPDSHGRGFEAPSDGRSPTPASISHLQRLLEALSEESRSSAPSGSGTGGQG 335

  Fly   363 VLSEFEGSGDAGEDPSAESEF 383
            :::.|..|....|.| |:|.|
  Rat   336 IIAGFVDSQQGWEHP-AQSTF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 72/213 (34%)
Astacin 144..339 CDD:279708 70/212 (33%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
AstlNP_001099974.1 Astacin 92..283 CDD:279708 71/210 (34%)
ZnMc 99..281 CDD:294052 66/198 (33%)
ImpA_N <305..420 CDD:303075 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.