DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and Tnfaip6

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:189 Identity:50/189 - (26%)
Similarity:74/189 - (39%) Gaps:37/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 CSMNNGGC----QHRCRNTFGSYQCSC------RNGYTLAENGHNC------------------- 792
            |....|..    |.......|.:.|:.      |.||.:.:.|.||                   
Mouse    58 CEFEGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSER 122

  Fly   793 --------TETRCKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQE 849
                    ....|....|....:.:||.:|.:|..|..||||.:...|.||.|:|.||::|....
Mouse   123 WDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYDDNQVCYWHIRLKYGQRIHLSFLDFDLEHDPG 187

  Fly   850 CIYDYVAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQRKGFKATFVS 908
            |:.|||.|||...:....:|.|||...|..:|::.|.|.:...:||.:...||:..:|:
Mouse   188 CLADYVEIYDSYDDVHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGFQIKYVT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342 9/44 (20%)
CUB 797..906 CDD:278839 38/108 (35%)
CUB 910..1023 CDD:278839
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592 11/69 (16%)
CUB 135..244 CDD:278839 38/108 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.