DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and CDCP2

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001340584.1 Gene:CDCP2 / 200008 HGNCID:27297 Length:540 Species:Homo sapiens


Alignment Length:475 Identity:142/475 - (29%)
Similarity:217/475 - (45%) Gaps:83/475 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 CQHLCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPDVYPNSKQCVWEV 666
            |..|.:..||       .|.:.||....   .||||:.|...|.|  ||::|.:||.:.:|.|.:
Human     8 CLLLAVALLG-------PGLQAQAMEGV---KCGGVLSAPSGNFS--SPNFPRLYPYNTECSWLI 60

  Fly   667 VAPPNHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSIL 731
            |.....:|.|.|..||||   :|.| |::|:|.||:....::...:|.:||...||...|...::
Human    61 VVAEGSSVLLTFHAFDLE---YHDT-CSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVM 121

  Fly   732 RLEFYSDRTVQRSGFVAKFVIDVDECSMNNGGCQHRCRNTFGSYQCSCRNGYTLAENGHNCTETR 796
            .:.|:||:.|...||.|.:..||                                          
Human   122 SVIFHSDKHVASHGFSAGYQKDV------------------------------------------ 144

  Fly   797 CKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQECIYDYVAIYDGR 861
            |...:|...|||.||.||.:||.::.|:|..:......::|.|.||:||.::||.|||||:..| 
Human   145 CGGVLTGLSGVLTSPEYPNNYPNSMECHWVIRAAGPAHVKLVFVDFQVEGNEECTYDYVAVLGG- 208

  Fly   862 SENSSTLG-IYCGGREPYAVIASTNEMFMVLATDAGLQRKGFKATFVS-ECGGYLRATNHSQTFY 924
              ...|.| .|||...|..:::..:|:.:|..:|..:..:||||.:.| ||.....|...:   :
Human   209 --PGPTRGHHYCGSTRPPTLVSLGHELQVVFKSDFNIGGRGFKAYYFSGECQEVYMAMRGN---F 268

  Fly   925 SHPRYGSRPYKRNMYCDWRIQADPESSVKIRFLHFEIE----YSERCDYDYLEITEEGYSMNTIH 985
            |.|:|.| .|..|:.|.|.|:..|...||:.||..::|    .::.||:|:|...:.......:.
Human   269 SSPQYPS-SYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLL 332

  Fly   986 GRFCGKHKPPIIISNSDTLLLRFQTDESNSLRGFAISFMAVDPPEDSVGE-DF------DAVTPF 1043
            |.:||.|.||.:.|:.:.|||...||.|.:.|||:::::.|.|...|... ||      .|:.|.
Human   333 GNWCGHHLPPPVTSSHNQLLLLLHTDRSTTRRGFSVAYIGVVPMNVSCSRTDFQILISTQALAPL 397

  Fly  1044 PG---YL--KSMYSSETGSD 1058
            ..   ||  :|..:.|.|.:
Human   398 ERTKVYLGSRSCAAQEVGGN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342 7/27 (26%)
CUB 634..750 CDD:278839 42/115 (37%)
FXa_inhibition 757..792 CDD:291342 0/34 (0%)
CUB 797..906 CDD:278839 40/109 (37%)
CUB 910..1023 CDD:278839 37/116 (32%)
CDCP2NP_001340584.1 CUB 30..141 CDD:238001 42/116 (36%)
CUB 145..254 CDD:238001 40/111 (36%)
CUB 257..370 CDD:278839 37/116 (32%)
Zona_pellucida 380..>463 CDD:332579 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.