DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and Y19D10A.6

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_503652.3 Gene:Y19D10A.6 / 189484 WormBaseID:WBGene00021221 Length:272 Species:Caenorhabditis elegans


Alignment Length:278 Identity:73/278 - (26%)
Similarity:112/278 - (40%) Gaps:94/278 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SQNKAALRLPPPFLWTDDAVDVLQHSHSPTLNGQ---PIQRRRRAVTVR----KERTWDYGVIPY 153
            |:|....:||               :..|:..|.   |: |::|.:.:.    ....|....:||
 Worm    19 SENNILTKLP---------------TFEPSKYGHINIPL-RKKRGIALHPLQWASYLWPNAEVPY 67

  Fly   154 EIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYI----YFTVKNCGCCSFLGK----- 209
            :|.|.::...|::...||..::|.||::|..|... ..:|:    ||.|:.  |.|::|:     
 Worm    68 DIATHYTSTEKSIILSAMEAFKNVTCVRFRPRAAT-DKHYLQINKYFNVER--CFSYIGRQSSRT 129

  Fly   210 --------------------NGNGRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVI 254
                                .||||            ||::|||.|.:||:|||.|.|||:.|| 
 Worm   130 LFGTPEGNVETRMRLDPACLRGNGR------------GIVMHELMHILGFYHEHQRDDRDRRIV- 181

  Fly   255 NKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQ 319
              |:.:   .|||.:....:. |.:..||.||||||   :|...|:                 .:
 Worm   182 --GSAV---HYNFKIYRRAKT-LYMGAYDANSIMHY---NFQNLPW-----------------QR 220

  Fly   320 RKRLSRGDIVQANLLYKC 337
            |...|..||:..|..|||
 Worm   221 RDHFSTSDIININTFYKC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 64/234 (27%)
Astacin 144..339 CDD:279708 64/223 (29%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
Y19D10A.6NP_503652.3 Astacin 58..240 CDD:279708 64/223 (29%)
ZnMc 62..236 CDD:294052 60/215 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.