DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and nas-5

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_492616.1 Gene:nas-5 / 188819 WormBaseID:WBGene00003524 Length:360 Species:Caenorhabditis elegans


Alignment Length:302 Identity:84/302 - (27%)
Similarity:124/302 - (41%) Gaps:60/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PIQRR----RRAVTVRKERTW--------DYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKF 182
            ||:.|    |.|:.......|        :| :|||.|...:....:...|.||....|.|||:.
 Worm    51 PIRERRPIFRNALLSNSPLRWSKMQDLDGNY-LIPYVISGNYDTVERDTIKTAMEKIANNTCIRL 114

  Fly   183 VER--DPNLHANYIYFTVKN---CGCCSFLGKNGNGRQPISIGRN----CEKFGIIIHELGHTIG 238
            :.|  .|:      |..:.|   .||.:.:|: ..|:..:.:..|    |.:...:||||.|.||
 Worm   115 IPRTNQPD------YAEINNKKGQGCYASIGR-FPGKNVVMLESNDDQSCIQEDTVIHELFHVIG 172

  Fly   239 FHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDT 303
            ..|||.|.|||..|.:...||...|...|:.||..:.....:|||.||:|||.:|:|:|...:..
 Worm   173 LWHEHMRADRDAFINVLYKNIEPAQYPQFEKLSSRDATTYSVPYDYNSVMHYDENAFAKPGKISM 237

  Fly   304 ITP-------IGIPPGTHLELGQRKRLSRGDIVQANLLYKCASCGRTYQQNSGHIVSPHFIYSGN 361
            :|.       ||.|          |..|..|..:...:|.|:.|   ..|:...||....|...|
 Worm   238 MTKDSKFQKVIGHP----------KDASSNDYKKVCAIYHCSKC---MHQDFQQIVEQEHIELNN 289

  Fly   362 GVLSEFE-GSGDAGED-----PSAESEFDASLTNCEWRITAT 397
            .:::... ..||:..|     |..:|.   .:.||  ::.||
 Worm   290 PIITNAPVQQGDSCTDRLGICPMLKSR---EMLNC--KVMAT 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 64/224 (29%)
Astacin 144..339 CDD:279708 64/218 (29%)
CUB 388..474 CDD:214483 4/10 (40%)
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
nas-5NP_492616.1 ZnMc_astacin_like 80..266 CDD:239807 61/203 (30%)
Astacin 83..269 CDD:279708 61/202 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.