DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and nas-3

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_505445.2 Gene:nas-3 / 187045 WormBaseID:WBGene00003522 Length:292 Species:Caenorhabditis elegans


Alignment Length:302 Identity:73/302 - (24%)
Similarity:116/302 - (38%) Gaps:82/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FFGILDSSLVPPKEP-KDDIYQLKTTRQHSGRRRKQSHKSQNKAALRLPPPFLWTDDAVDVLQHS 121
            ||.:|..:.....|| |||...:|.               ..|.::..||    .||.:.|    
 Worm     7 FFSLLALTASKVSEPEKDDEIAVKI---------------PTKRSVSEPP----KDDDIAV---- 48

  Fly   122 HSPTLNGQPIQRRRRAVTVR----KERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKF 182
                   :...|::|.:.:.    :...|....:||:|.:.::...:.:...||..:.:.||::|
 Worm    49 -------KIPMRKKRGIAIHPWQWESHLWPNAEVPYDIASHYTATERGIILSAMEAFRDVTCVRF 106

  Fly   183 VERDPN----LHANYIYFTVKNCGCCSFLG----------KNGNGRQPISIGRNCEKF---GIII 230
            ..|...    |..|..|...:   |.|::|          ::|.....:.:..:|..:   |.::
 Worm   107 RPRRSTDKHYLQINKHYQLER---CFSYIGRQSSRWLFGTRDGKVETRMKLDPSCLLYNGRGTVM 168

  Fly   231 HELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSF 295
            |||.|.:||:|||.|.|||:.|    |.  ....|||.:....: ...:..||.||||||   :|
 Worm   169 HELMHILGFYHEHQRDDRDRRI----GG--SASHYNFKIYQRAK-SYYMGGYDANSIMHY---NF 223

  Fly   296 SKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKC 337
            ...|:                 .:|...|..||...|.||||
 Worm   224 GSVPW-----------------QKRDYFSPSDIRNINTLYKC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 56/222 (25%)
Astacin 144..339 CDD:279708 56/211 (27%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
nas-3NP_505445.2 Astacin 69..250 CDD:279708 56/210 (27%)
ZnMc 72..246 CDD:294052 51/203 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.