DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and nas-17

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_505892.1 Gene:nas-17 / 186923 WormBaseID:WBGene00003536 Length:448 Species:Caenorhabditis elegans


Alignment Length:442 Identity:96/442 - (21%)
Similarity:156/442 - (35%) Gaps:134/442 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DDAVD---VLQHSHSPTLNGQPIQRRRRAVTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRH 173
            |..||   :|..:....|||...:.:|:...:.|:  |....:.|..:..|:...:.|...||.|
 Worm    55 DGIVDGDIMLTEAQLRILNGTAKRSKRQITKIWKK--WPDAKVFYYYENEFTSLKRELMSYAMAH 117

  Fly   174 WENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIG 238
            ..:.||:||  ::.|...|.|.|| ...||.|::|.|| |.|.:..|..|..||..:||:.|::|
 Worm   118 ISSNTCVKF--QESNSATNRIRFT-NTGGCASYIGMNG-GEQTLWFGDGCLIFGTAVHEIMHSLG 178

  Fly   239 FHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYL-- 301
            ..|.|:|.|||..:.::..::......|.: ...|:.....:|::..|.|.|..|:|.:...:  
 Worm   179 LFHTHSRFDRDNFLSVSYKDVPENMVGNLE-KETEQTTYNAVPFEYGSTMLYRYNTFGEGTLVSK 242

  Fly   302 --DTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCASCGRTYQQNSGHIVSPHFIYSGNGVL 364
              |....:|:           :|:|..|:|..|:.|   |||                       
 Worm   243 NEDYQKTMGL-----------RRVSFYDLVNINVRY---SCG----------------------- 270

  Fly   365 SEFEGSGDAGEDPSAESEFDASLTNCEWRITATNGEKVILHLQQLHLMSSDDCTQDYLEIRDGYW 429
                                     |...:|..||                           ||.
 Worm   271 -------------------------CAKSLTCENG---------------------------GYT 283

  Fly   430 HKSPLVRRIC-----GNVSGEVITTQTSRMLLNYVNRNAAKGYRGFKARFEVVCGGDLKLTKDQS 489
            :.|.....:|     |.:..|..:        |.:...|...::|:...|..          ..|
 Worm   284 NPSNCATCVCPTGFAGTLCNEAPS--------NTIKLTAESYWKGYWVNFGY----------STS 330

  Fly   490 IDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFE-LEKHDGCAYDFVEIR 540
            |.:.||.:.|:      | ||||.:..:.:|..... .....||.|:.||::
 Worm   331 IQTTNYYLAYL------W-ITAPADKTIEVKIMDLSGFTCSYGCNYNGVEVK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 55/204 (27%)
Astacin 144..339 CDD:279708 54/198 (27%)
CUB 388..474 CDD:214483 13/90 (14%)
CUB 478..586 CDD:278839 16/64 (25%)
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
nas-17NP_505892.1 Astacin 88..271 CDD:279708 58/251 (23%)
ZnMc_astacin_like 92..267 CDD:239807 52/190 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.