DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and nas-29

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_494953.3 Gene:nas-29 / 186488 WormBaseID:WBGene00003547 Length:532 Species:Caenorhabditis elegans


Alignment Length:550 Identity:124/550 - (22%)
Similarity:188/550 - (34%) Gaps:203/550 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPTLNG-----QPIQRRRRAVTVRKERT-----------------WDYGVIPYEIDTIFSGAHKA 165
            |..:||     :.|:.|||...:..|.|                 |..||.....:::...|..|
 Worm   102 SMIVNGSTEYRKAIKSRRRGNKINGESTDRTKRQAYLDNNYPATIWKNGVAFMFHESLTPIAKTA 166

  Fly   166 LFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKNGN-GRQPISIGRNCEKFGII 229
            :.| |:..|...|||:|..|  .....|:.|...:.||.|.:|::.: |:|.:|||..||.||:.
 Worm   167 ILK-AVHFWYRETCIEFHPR--TFQKEYLLFIGNDDGCWSTVGRDASQGKQVVSIGNGCEHFGVT 228

  Fly   230 IHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNS 294
            .|||.|.:|..||.:|.|||:.:|.|...:.|...:||..:||.::....||||:.|:|||....
 Worm   229 SHELAHALGIFHEQSRFDRDESVVFNPRVVERDLLFNFAKISPRQMSTYGLPYDIGSVMHYTPTE 293

  Fly   295 FSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCASCGRTYQQNSGHIVSPHFIYS 359
            ||..|.:.|:..|                      ..||           ||..|.:..|.|   
 Worm   294 FSNIPSIPTLAAI----------------------DTNL-----------QQTMGQLEGPSF--- 322

  Fly   360 GNGVLSEFEGSGDAGEDPSAESEFDASLTNCEWRITATNGEKVILHLQQLHLMSSDDC-TQDYLE 423
                                                      |.:|:...|....:.| ||    
 Worm   323 ------------------------------------------VDVHIMNQHYQCQEKCPTQ---- 341

  Fly   424 IRDGYWHKSPLVRRICGNVSGEVITTQTSRMLLNYVNRNAAKGYRGF--------KARFEVVCGG 480
                    :|     |.|..           ..|..|....|...||        .:.|...|||
 Worm   342 --------AP-----CQNGG-----------FTNSRNCKVCKCPTGFGGAYCQLIASSFSPFCGG 382

  Fly   481 DLK---------LTKDQSIDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFELEKHDGCAYDF 536
            .|.         :|..||..:.:        |.||:.|.||:..::.:.....:.:..:||..|.
 Worm   383 YLNAEETTRRFDITIRQSTTTRS--------KTCVYHIKAPEGKRIIIDILKIDSKCIEGCWQDG 439

  Fly   537 VEIRDGNHSDSRLIG-RFC------------GDKLPPNIKTRSNQMYIR---------------- 572
            :|::  ...|.|.:| |||            |:.:|..:.::.:...:.                
 Worm   440 LELK--MKKDFRPVGYRFCCPESSRRKVISEGNMVPFMVFSKEHDFSVSFEYSFVSTSAGFDDEK 502

  Fly   573 -------------FVSDSS-VQKLGFSAAL 588
                         ||||:| :|::||...|
 Worm   503 NDSDVIVDNLDGVFVSDTSLLQRIGFRRQL 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 63/218 (29%)
Astacin 144..339 CDD:279708 62/212 (29%)
CUB 388..474 CDD:214483 14/94 (15%)
CUB 478..586 CDD:278839 33/159 (21%)
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
nas-29NP_494953.3 Astacin 145..336 CDD:279708 69/271 (25%)
ZnMc_astacin_like 148..332 CDD:239807 67/264 (25%)
CUB 404..491 CDD:214483 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.