DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and Pcolce

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_032814.2 Gene:Pcolce / 18542 MGIID:105099 Length:468 Species:Mus musculus


Alignment Length:289 Identity:83/289 - (28%)
Similarity:136/289 - (47%) Gaps:43/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 AKGYRGFKARFEVVCGGDLKLTKDQS-IDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFELE 527
            |:|......|...:||||  :|.:.. :.|..:|..|.|:|:|:|.||.|:...|:|.|:.|::|
Mouse    22 ARGQTPNYTRPVFLCGGD--VTGESGYVASEGFPNLYPPNKKCIWTITVPEGQTVSLSFRVFDME 84

  Fly   528 KHDGCAYDFVEIRDGNHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAALMLDV 592
            .|..|.||.:|:..|:.:..:.:|||||...|..:....||:.:|..:|......||        
Mouse    85 LHPSCRYDALEVFAGSGTSGQRLGRFCGTFRPAPVVAPGNQVTLRMTTDEGTGGRGF-------- 141

  Fly   593 DECKFTDHGCQHLCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPDV-Y 656
                                     ...|..:|...|....|||.::  |:.|:|.:|::|:. |
Mouse   142 -------------------------LLWYSGRATSGTEHQFCGGRME--KAQGTLTTPNWPESDY 179

  Fly   657 PNSKQCVWEVVAPPNHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELP 721
            |....|.|.::||.|..:.|.|..||:|..    |.|.||.:.:::....:..|::|.:||.:.|
Mouse   180 PPGISCSWHIIAPSNQVIMLTFGKFDVEPD----TYCRYDSVSVFNGAVSDDSKRLGKFCGDKAP 240

  Fly   722 PVVNSEQSILRLEFYSDRTVQRSGFVAKF 750
            ..::||.:.|.::|.||.:|...||.|.:
Mouse   241 SPISSEGNELLVQFVSDLSVTADGFSASY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483 2/9 (22%)
CUB 478..586 CDD:278839 38/108 (35%)
FXa_inhibition 595..630 CDD:291342 2/34 (6%)
CUB 634..750 CDD:278839 39/116 (34%)
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
PcolceNP_032814.2 CUB 36..146 CDD:238001 38/144 (26%)
CUB 158..271 CDD:238001 39/118 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..338
NTR_PCOLCE 334..460 CDD:239631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.