DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and clec-3

DIOPT Version :10

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_494426.2 Gene:clec-3 / 183396 WormBaseID:WBGene00016577 Length:409 Species:Caenorhabditis elegans


Alignment Length:304 Identity:69/304 - (22%)
Similarity:108/304 - (35%) Gaps:99/304 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 CEDACGGVVDATKSNGSLYSPSYPD-----------VYPNSKQCVWEVVAPPNHAVFLNFSHFDL 683
            ||:.||.:|....:|.:.|..:...           ::|......|                  :
 Worm   177 CEEECGNLVSIHSANENRYLMNIASHRASDNVLIGGMWPMDHMNTW------------------V 223

  Fly   684 EGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSILRLEFYSDRTVQRSGFVA 748
            :||.:.|:  |.|                         .|.|.:...:.:               
 Worm   224 DGTMWDYS--NID-------------------------SVYNPKNRCIAM--------------- 246

  Fly   749 KFVIDVDECSMNNGGCQHRCRNTFG-------SYQCSCRNGYTLAENGHNCT-------ETRCKF 799
                      .|||..::.....||       |:.|....|...:.:....|       |:.|..
 Worm   247 ----------ANNGTSEYNLGQWFGVDCEGLSSFFCK
RPAGVPCSTDQPKVTVTPVPSNESFCNS 301

  Fly   800 EITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQECIYDYVAIYDGRSEN 864
            .:..:.|::.|||||::|..|:||.:...|:..:.|.|.|..|..|.:    .|.|.:|||.|.|
 Worm   302 TVLMTPGIITSPNYPQNYDNNVYCSYKLSTLGSYNILLEFTSFSTEEN----VDLVTVYDGESTN 362

  Fly   865 SSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQRKGFKATFVS 908
            ...:|.|.|.|||:.:|:..|..|:..|||:....|||.||||:
 Worm   363 GLKIGTYSGSREPFHLISKGNNFFVTFATDSRNVFKGFSATFVA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
CUB 388..474 CDD:214483
CUB 478..586 CDD:395345
FXa_inhibition 595..630 CDD:464251 69/304 (23%)
CUB 634..750 CDD:395345 14/126 (11%)
FXa_inhibition 757..792 CDD:464251 8/41 (20%)
CUB 797..906 CDD:395345 40/108 (37%)
CUB 910..1023 CDD:395345
clec-3NP_494426.2 CLECT 22..143 CDD:214480
CLECT 163..273 CDD:214480 22/165 (13%)
CUB 299..406 CDD:238001 42/110 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.