DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and nas-8

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_501114.2 Gene:nas-8 / 183207 WormBaseID:WBGene00003527 Length:403 Species:Caenorhabditis elegans


Alignment Length:331 Identity:96/331 - (29%)
Similarity:149/331 - (45%) Gaps:42/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVLSVGALWMMMFFLVDYAEGRRLSQLPESECDFDFKEQPEDFFGIL--DSSLVPPKEPKDDIYQ 78
            :.:.:.:|.:.:..:..||..:.|  ||.|.....|... |||...|  |.:.:..|:.|:.   
 Worm    11 ITIFLSSLSLFVIIIPIYAAEKDL--LPPSTSSETFLTD-EDFLRPLNDDETFLTEKDFKNG--- 69

  Fly    79 LKTTRQH---SGRRRKQSHKS---QNKAALRLPPPFLWTDDAVDVLQHSHSPTLNGQPIQRRRRA 137
            .|....|   .....||.:|.   :.|||.:|.|            ::|.|...||         
 Worm    70 EKLGEDHVPAGSILWKQVYKKGDIRGKAAWKLDP------------KNSESLRRNG--------- 113

  Fly   138 VTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCG 202
             .:...|.|..|.|||.|...::...:|:..::.:.:.:.||::||.|.. :..:|:|.. |..|
 Worm   114 -VITGTRKWPNGRIPYVISNQYNDRERAVLARSFQAYHDKTCVRFVPRTA-VDNDYLYIG-KIDG 175

  Fly   203 CCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNF 267
            |.|.:|:.| |||.:|:...|.::...||||.|::||:|||.|.|||:||.|...||.|.....|
 Worm   176 CYSDVGRAG-GRQELSLDNGCLQYDTAIHELMHSVGFYHEHERWDRDEHITILWHNIDREAYDQF 239

  Fly   268 DVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQAN 332
            ..:...|.......||..|||||...:|||:.:   .|.:.........:|.....|..||::.|
 Worm   240 GKVDLAESSYYGQLYDYYSIMHYDSLAFSKNGF---ETMVAKQSEMTAVIGAAIDFSPIDILKMN 301

  Fly   333 LLYKCA 338
            |:|:|:
 Worm   302 LMYQCS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 66/200 (33%)
Astacin 144..339 CDD:279708 67/195 (34%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
nas-8NP_501114.2 Astacin 119..308 CDD:279708 67/195 (34%)
ZnMc_astacin_like 123..304 CDD:239807 63/186 (34%)
ShK 337..372 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.