DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and nas-12

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_501871.2 Gene:nas-12 / 182848 WormBaseID:WBGene00003531 Length:384 Species:Caenorhabditis elegans


Alignment Length:225 Identity:82/225 - (36%)
Similarity:117/225 - (52%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 RAVTVR--KERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTV 198
            |.|:::  ....|...::||.|...:|.|.|.:...::|::|..:|.|||||...   |...|.|
 Worm    71 RGVSIKGSSMNRWSNNIVPYVISPQYSPAQKQILVSSLRYFERVSCFKFVERTTQ---NDYLFIV 132

  Fly   199 KNCGCCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQ 263
            ...||.|::||.| |||.:|:..:|....||.||:.|.|||.|||.|.|||..|.::..|::.||
 Worm   133 PLDGCYSYVGKIG-GRQTLSLAADCIADYIIWHEMMHAIGFEHEHQRPDRDSFIRVDYANVIPGQ 196

  Fly   264 EYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSF-----SKSPYLDTITPIGIPPGTHLELGQRKRL 323
            ..|||.|....|:.|.: ||..|||||...:|     ::...|.|:||  :.||..||  ...:.
 Worm   197 MINFDKLKTSHVEYPDI-YDFKSIMHYDGYAFGRVDTARRVRLATMTP--LKPGVTLE--DNMKF 256

  Fly   324 SRGDIVQANLLYKCASCGRTYQQNSGHIVS 353
            :..||.:.|.|.:|.:.|..| .|.|.:.|
 Worm   257 TATDIEKLNRLGQCGARGGQY-SNQGVVAS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 75/207 (36%)
Astacin 144..339 CDD:279708 75/199 (38%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
nas-12NP_501871.2 Astacin 81..272 CDD:279708 75/199 (38%)
ZnMc_astacin_like 85..267 CDD:239807 72/190 (38%)
ShK 286..325 CDD:279838 82/225 (36%)
ShK 347..384 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.