DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and clec-57

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_506587.2 Gene:clec-57 / 179951 WormBaseID:WBGene00008594 Length:376 Species:Caenorhabditis elegans


Alignment Length:315 Identity:70/315 - (22%)
Similarity:120/315 - (38%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 CINTLGSYQCGCRAGYELQANGKTCEDA---CGGVV--DATKSNGSLYSPSYPDVYPNSKQCVWE 665
            |:...|:...|.:.....|.....|:..   |.|.|  .:.|..|::.||.||..|.|:..|.:.
 Worm   118 CVTFKGATPFGLQVTQCYQFQPAFCK
QTPALCNGGVFGGSDKWTGTIQSPGYPVQYYNNLNCNYL 182

  Fly   666 VVAPPNHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSI 730
            :::|.|..:.:.||.|.:|..        ||.:.::.....|.:..||....:.|.....|..::
 Worm   183 IISPNNTFITILFSPFLVEEW--------YDLVDVFDGNSTNYVDHIGQVSSYNLARGFESSTNM 239

  Fly   731 LRLEFYSDRTVQRSGFVAKFVIDVDECSMNNGGCQHRCRNTFGSYQCSCRNGYTLAENGHNCTET 795
            :.:.|.::..:...|::|.:....|...::..|                                
 Worm   240 MTVRFKTNYDITDKGWLATWKAKKDMPVISQSG-------------------------------- 272

  Fly   796 RCKFEITTSYGVLQSPNYP---EDYPRNIYCYWHFQTVLGHRIQLTFHDFEVESHQECIYDYVAI 857
                    |.|.:.|||||   :.|...:|   ......|.::.||...|..|:.    |||:.|
 Worm   273 --------SNGTMVSPNYPLTYDSYDEQVY---QISVAWGMQVNLTIDVFRTENK----YDYLNI 322

  Fly   858 YDGRSENSSTLGIYCGGRE--PYAVIASTNEMFMVLATDAGLQRKGFKATFVSEC 910
            |:..::::|||.....|:.  |:..|:..:.|.|...:|..||..|:.| |.|.|
 Worm   323 YNSTTQSNSTLVTTLSGQSVAPFNYISPRSYMSMKFVSDGSLQYTGWHA-FWSIC 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342 4/23 (17%)
CUB 634..750 CDD:278839 28/117 (24%)
FXa_inhibition 757..792 CDD:291342 1/34 (3%)
CUB 797..906 CDD:278839 32/113 (28%)
CUB 910..1023 CDD:278839 1/1 (100%)
clec-57NP_506587.2 CLECT 21..143 CDD:214480 4/24 (17%)
CUB 149..261 CDD:238001 28/119 (24%)
CUB 275..373 CDD:214483 31/105 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.993157 Normalized mean entropy S7146
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.