| Sequence 1: | NP_524487.2 | Gene: | tld / 42945 | FlyBaseID: | FBgn0003719 | Length: | 1067 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_741532.1 | Gene: | nas-9 / 178875 | WormBaseID: | WBGene00003528 | Length: | 546 | Species: | Caenorhabditis elegans |
| Alignment Length: | 203 | Identity: | 62/203 - (30%) |
|---|---|---|---|
| Similarity: | 93/203 - (45%) | Gaps: | 13/203 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 146 WD-YGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKF-VERDP-NLHANYIYF-TVKNCGCCSF 206
Fly 207 LGKNGNGRQPISIGRNC-EKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVL 270
Fly 271 SPEEVDLPL---LPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQAN 332
Fly 333 LLYKCASC 340 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tld | NP_524487.2 | ZnMc_BMP1_TLD | 137..338 | CDD:239808 | 61/199 (31%) |
| Astacin | 144..339 | CDD:279708 | 61/200 (31%) | ||
| CUB | 388..474 | CDD:214483 | |||
| CUB | 478..586 | CDD:278839 | |||
| FXa_inhibition | 595..630 | CDD:291342 | |||
| CUB | 634..750 | CDD:278839 | |||
| FXa_inhibition | 757..792 | CDD:291342 | |||
| CUB | 797..906 | CDD:278839 | |||
| CUB | 910..1023 | CDD:278839 | |||
| nas-9 | NP_741532.1 | Astacin | 311..505 | CDD:279708 | 60/196 (31%) |
| ZnMc_astacin_like | 316..505 | CDD:239807 | 58/193 (30%) | ||
| ShKT | 510..546 | CDD:214586 | 1/1 (100%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||