DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and LOC1274338

DIOPT Version :10

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:XP_313445.5 Gene:LOC1274338 / 1274338 VectorBaseID:AGAMI1_000754 Length:311 Species:Anopheles gambiae


Alignment Length:204 Identity:74/204 - (36%)
Similarity:103/204 - (50%) Gaps:16/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 ERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVK-NCGCCSF 206
            ||.|..|.:||.|..::....:....||:|.....||:.||..:.......:.:.:| ..||.|:
Mosquito    96 ERVWPNGTVPYAISPLYDVDDQVTILQAIRTLNFMTCVNFVPWNGKDKDFLLIWPIKYPKGCWSY 160

  Fly   207 LGKNGNGRQPISI------GRNC-EKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQE 264
            :||.| |.|.:|:      ..|| ...|..||||.|.:|..||.:|.|||:.:.|...||:...:
Mosquito   161 VGKIG-GTQIVSLQPPDDRSPNCLGNEGRAIHELMHALGIFHEQSRADRDRFVKIIWDNIIPAFK 224

  Fly   265 YNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTI-TPIGIPPGTHLELGQRKRLSRGDI 328
            .||:..|.:..... ..||.||||||.||.||......|| |.:   ||  ::||||:.||:.|.
Mosquito   225 SNFEKQSLKNTTYS-FEYDYNSIMHYGKNYFSIGKGKTTIETKM---PG--IKLGQRQALSKTDC 283

  Fly   329 VQANLLYKC 337
            ::.|.||||
Mosquito   284 LKINDLYKC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 74/204 (36%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:395345
FXa_inhibition 595..630 CDD:464251
CUB 634..750 CDD:395345
FXa_inhibition 757..792 CDD:464251
CUB 797..906 CDD:395345
CUB 910..1023 CDD:395345
LOC1274338XP_313445.5 ZnMc_astacin_like 101..290 CDD:239807 67/195 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.