DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tld and mep1ba

DIOPT Version :9

Sequence 1:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001070089.2 Gene:mep1ba / 100151009 ZFINID:ZDB-GENE-041014-209 Length:677 Species:Danio rerio


Alignment Length:510 Identity:128/510 - (25%)
Similarity:204/510 - (40%) Gaps:130/510 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKNGNGRQ 215
            :||.:|.......|.:..:|...:...|||.|  :..|..:||| |..|..||.|.:|....|:|
Zfish    78 VPYFLDNSLEINAKGVILKAFEQYRLKTCIDF--KPWNGESNYI-FVFKGSGCYSKVGNRQMGKQ 139

  Fly   216 PISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLL 280
            .:|||.||:..|.:.||..|.:|..||.:|.|||.:::|....|..|:|:||::....:.....:
Zfish   140 ELSIGSNCDSLGTVEHEFLHALGLWHEQSRSDRDDYVIIVWDQIQDGKEHNFNLYDETQSSSLGV 204

  Fly   281 PYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYKCASCGRTYQ 345
            |||.:|:|||:|.||:|......:|.|   |.....:|||...|..|:::.|.||.|.: ..|: 
Zfish   205 PYDYSSVMHYSKTSFNKGSEPTIVTKI---PEFLNVIGQRMEFSDNDLLKLNRLYNCTT-SSTF- 264

  Fly   346 QNSGHIVSPHFIYSGNGVLSEFEGSGDAGE---------DPSAESEFDASLTNCEW--------R 393
            .:|.|...|:..    |::     .||.|.         :...:::: .:|..|:.        .
Zfish   265 LDSCHFEEPNIC----GMI-----QGDGGNAKWARVQTVEGGPKTDY-TNLGQCQGVGFFMHFST 319

  Fly   394 ITATNGEKVILHLQQLHLMSSDDCTQDY------------LEIRDGYWHKSP-----LVRRICGN 441
            .|...|:|..|..:..:......|.|.|            :.:|: |..::|     |:::|.|.
Zfish   320 ATGAQGDKAHLESRLFYPNRRSQCLQFYHYNSGGTDDQLNIWVRE-YTAENPKGDLRLIQQISGG 383

  Fly   442 V--SGEV--ITTQTSRMLLNYVNRNAAKGYRGFKARFEVVCGGDLKLTKDQSIDSPNYPMDYMPD 502
            :  |.|:  :|...|..               |:..||.|.|.|.. ....|:|..|     :.:
Zfish   384 LKDSWELYHVTLDVSSK---------------FRVVFEGVKGRDTS-KGGLSLDDIN-----LSE 427

  Fly   503 KEC---VWRI---------TAPDNHQVALKFQSFELEKHDGCAYD-----------------FVE 538
            .:|   .|||         |||.:     |..|..|...||.::.                 ::.
Zfish   428 TQCPQHTWRIRDFTKLLATTAPGS-----KIYSPRLLSPDGYSFQIGLYINGLKDSPDKMAIYLH 487

  Fly   539 IRDGNHSDS-------RLIGRFCGDKLPPNIKTRSNQMYIRFV--------SDSS 578
            :..|.|.|:       |.......|: .|:|:.|.|.  ||.:        :|||
Zfish   488 LTSGPHDDNLQWPCPWRQASMEMMDQ-NPDIQRRMNN--IRMITTDPDKTSTDSS 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 65/186 (35%)
Astacin 144..339 CDD:279708 66/187 (35%)
CUB 388..474 CDD:214483 19/114 (17%)
CUB 478..586 CDD:278839 31/145 (21%)
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
mep1baNP_001070089.2 ZnMc_meprin 29..258 CDD:239809 65/185 (35%)
Astacin 72..260 CDD:279708 66/187 (35%)
MAM 268..432 CDD:279023 35/195 (18%)
MAM 268..430 CDD:99706 34/193 (18%)
MATH_Meprin_Beta 430..599 CDD:239751 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.