DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and Tnfaip6

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 / 84397 RGDID:621359 Length:275 Species:Rattus norvegicus


Alignment Length:234 Identity:63/234 - (26%)
Similarity:107/234 - (45%) Gaps:37/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1185 VWHFITTPGHRIKLIFNEFDVESHQECTYD--NVAVYDGESESSSVLG-RFCG------DKIPFP 1240
            |:|.....| |.||.:    .|:...|.|:  .:|.|. :.|::..:| ..|.      .::.:|
  Rat    37 VYHREARAG-RYKLTY----AEAKAVCEYEGGRLATYK-QLEAARKIGFHVCAAGWMAKGRVGYP 95

  Fly  1241 I---------SSTSNQMYMVLKTDKNKQKNGFTAS-HSTACGGYLRATSQVQQFYSHARFGNQDY 1295
            |         ..|....|.: :.:::::.:.:..: ::..|||..   :..::.:....|.| :|
  Rat    96 IVKPGPNCGFGKTGIIDYGI-RLNRSERWDAYCY
NPNAKECGGVF---TDPKRIFKSPGFPN-EY 155

  Fly  1296 DDGMDCEWTIAAPDNSYVQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQ 1360
            ||...|.|.|.......:.|.||.||:|....|..|||:::...|||:|    ..|:|||:.||:
  Rat   156 DDNQVCYWHIRLKYGQRIHLSFLDFDLEHDPGCLADYVEIYDSYDDVHG----FVGRYCGDELPE 216

  Fly  1361 DINSMTHSLLVRFKTDGSVPMKGFSASYVAV---PNSGE 1396
            ||.|..:.:.::|.:|.||...||...||.|   |.|.:
  Rat   217 DIISTGNVMTLKFLSDASVTAGGFQIKYVTVDPAPKSNQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808
Astacin 527..721 CDD:279708
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839 18/100 (18%)
CUB 1271..1390 CDD:238001 41/118 (35%)
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592 18/97 (19%)
CUB 135..244 CDD:395345 40/116 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.