DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tok and pcolceb

DIOPT Version :9

Sequence 1:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster
Sequence 2:NP_001122259.1 Gene:pcolceb / 794872 ZFINID:ZDB-GENE-080722-44 Length:538 Species:Danio rerio


Alignment Length:274 Identity:86/274 - (31%)
Similarity:126/274 - (45%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   839 VCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVR 903
            :|||.|..|.  |.:.|..:|..|..|.:|.|.|||||.:.|.|:|:.|::|...:|.||||:|.
Zfish    34 LCGGHLVTDS--GFVASEGFPSHYKANSKCTWYITVPEGHVVMLQFRIFDLEADPTCRYDYVDVY 96

  Fly   904 DGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHE 968
            :|.......:|.|||...|..:.|:.|:|.::..||:|....||.|.|.                
Zfish    97 NGHSYTVQKLGRFCGTFRPGALISTSNTMMLEMASDSSTGGRGFLAYFS---------------- 145

  Fly   969 CINTLGGYECSCRIGFELHSDKKHCED--ACGGVIEYPNGTITSPSFPEM-YPLLKECIWEIVAP 1030
                 ||              |.|.::  .|||.:..|.|::.:|::||. ||....|.|.|...
Zfish   146 -----GG--------------KPHVDEHQFCGGRLTKPQGSVKTPNWPESDYPAGISCSWHISVE 191

  Fly  1031 PKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLE 1095
            ....|.:.|...|||...:    |.||.|.:::....:..:|||.|||.::|....:..|.|.:.
Zfish   192 SNMVIEVKFEKLDLELDTY----CRYDYVALFNGGETDDSRRIGKFCGDTVPDAVVTNGNELLVH 252

  Fly  1096 FHSDKSIQRSGFAA 1109
            |.||.|:..:||.|
Zfish   253 FVSDLSVTAAGFMA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808
Astacin 527..721 CDD:279708
CUB 723..836 CDD:294042
CUB 840..951 CDD:278839 43/110 (39%)
FXa_inhibition 958..993 CDD:291342 3/34 (9%)
CUB 997..1111 CDD:278839 38/114 (33%)
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
pcolcebNP_001122259.1 CUB 35..145 CDD:238001 43/111 (39%)
CUB 157..270 CDD:238001 38/114 (33%)
Hc1 <334..398 CDD:284776
NTR_like 416..538 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.