| Sequence 1: | NP_001287510.1 | Gene: | tok / 42944 | FlyBaseID: | FBgn0004885 | Length: | 1464 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001035333.2 | Gene: | tnfaip6 / 678516 | ZFINID: | ZDB-GENE-060421-2654 | Length: | 271 | Species: | Danio rerio |
| Alignment Length: | 217 | Identity: | 57/217 - (26%) |
|---|---|---|---|
| Similarity: | 86/217 - (39%) | Gaps: | 46/217 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1090 NALRLE-----FHSDKSIQRSGFAAVFFTDIDECAVNNGGC-----QHECRNTIGSYICMC---- 1140
Fly 1141 --HNGYSMHENGHDCKEG---------------------------ECKYEISAPFGTIFSPNYPD 1176
Fly 1177 SYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPI 1241
Fly 1242 SSTSNQMYMVLKTDKNKQKNGF 1263 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tok | NP_001287510.1 | ZnMc_BMP1_TLD | 520..721 | CDD:239808 | |
| Astacin | 527..721 | CDD:279708 | |||
| CUB | 723..836 | CDD:294042 | |||
| CUB | 840..951 | CDD:278839 | |||
| FXa_inhibition | 958..993 | CDD:291342 | |||
| CUB | 997..1111 | CDD:278839 | 6/25 (24%) | ||
| FXa_inhibition | 1118..1153 | CDD:291342 | 10/45 (22%) | ||
| CUB | 1158..1267 | CDD:278839 | 38/106 (36%) | ||
| CUB | 1271..1390 | CDD:238001 | |||
| tnfaip6 | NP_001035333.2 | Link_domain_TSG_6_like | 46..138 | CDD:239592 | 15/94 (16%) |
| CUB | 145..254 | CDD:278839 | 38/106 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||